Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9748
Gene name
LocationContig_730:9314..10781
Strand+
Gene length (bp)1467
Transcript length (bp)1170
Coding sequence length (bp)1170
Protein length (aa) 390

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 1.4E-11 127 307
PF12146 Hydrolase_4 Serine aminopeptidase, S33 3.9E-11 122 248
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 1.7E-09 123 233

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08C93|ABD12_DANRE Monoacylglycerol lipase ABHD12 OS=Danio rerio GN=abhd12 PE=2 SV=1 5 302 5.0E-21
sp|Q7Z5M8|AB12B_HUMAN Abhydrolase domain-containing protein 12B OS=Homo sapiens GN=ABHD12B PE=2 SV=1 123 315 8.0E-21
sp|B4F753|ABD12_XENTR Monoacylglycerol lipase ABHD12 OS=Xenopus tropicalis GN=abhd12 PE=2 SV=1 6 302 5.0E-18
sp|Q6AYT7|ABD12_RAT Monoacylglycerol lipase ABHD12 OS=Rattus norvegicus GN=Abhd12 PE=2 SV=1 30 302 7.0E-18
sp|Q99LR1|ABD12_MOUSE Monoacylglycerol lipase ABHD12 OS=Mus musculus GN=Abhd12 PE=1 SV=2 30 302 7.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08C93|ABD12_DANRE Monoacylglycerol lipase ABHD12 OS=Danio rerio GN=abhd12 PE=2 SV=1 5 302 5.0E-21
sp|Q7Z5M8|AB12B_HUMAN Abhydrolase domain-containing protein 12B OS=Homo sapiens GN=ABHD12B PE=2 SV=1 123 315 8.0E-21
sp|B4F753|ABD12_XENTR Monoacylglycerol lipase ABHD12 OS=Xenopus tropicalis GN=abhd12 PE=2 SV=1 6 302 5.0E-18
sp|Q6AYT7|ABD12_RAT Monoacylglycerol lipase ABHD12 OS=Rattus norvegicus GN=Abhd12 PE=2 SV=1 30 302 7.0E-18
sp|Q99LR1|ABD12_MOUSE Monoacylglycerol lipase ABHD12 OS=Mus musculus GN=Abhd12 PE=1 SV=2 30 302 7.0E-18
sp|Q5ZIN0|ABD12_CHICK Monoacylglycerol lipase ABHD12 OS=Gallus gallus GN=ABHD12 PE=2 SV=1 5 302 1.0E-17
sp|Q08DW9|ABD12_BOVIN Monoacylglycerol lipase ABHD12 OS=Bos taurus GN=ABHD12 PE=2 SV=1 5 302 2.0E-17
sp|Q8N2K0|ABD12_HUMAN Monoacylglycerol lipase ABHD12 OS=Homo sapiens GN=ABHD12 PE=1 SV=2 30 302 4.0E-17
sp|Q4R766|ABD12_MACFA Monoacylglycerol lipase ABHD12 OS=Macaca fascicularis GN=ABHD12 PE=2 SV=1 30 302 4.0E-17
sp|Q32LS6|ABHDD_DANRE Alpha/beta hydrolase domain-containing protein 13 OS=Danio rerio GN=abhd13 PE=2 SV=1 70 207 2.0E-14
sp|Q6IRP4|ABHDD_XENLA Alpha/beta hydrolase domain-containing protein 13 OS=Xenopus laevis GN=abhd13 PE=2 SV=1 124 218 9.0E-13
sp|P54069|BEM46_SCHPO Protein bem46 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bem46 PE=2 SV=3 105 310 3.0E-12
sp|Q8Z4M8|YHFR_SALTI Uncharacterized protein YfhR OS=Salmonella typhi GN=yhfR PE=3 SV=1 116 330 3.0E-11
sp|Q5ZJL8|ABHDD_CHICK Alpha/beta hydrolase domain-containing protein 13 OS=Gallus gallus GN=ABHD13 PE=2 SV=1 124 218 2.0E-10
sp|Q9KS12|MARTX_VIBCH Multifunctional-autoprocessing repeats-in-toxin OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rtxA PE=1 SV=2 121 254 4.0E-10
sp|Q8ZN39|YFHR_SALTY Uncharacterized protein YfhR OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=yfhR PE=3 SV=1 116 329 4.0E-10
sp|Q80UX8|ABHDD_MOUSE Alpha/beta hydrolase domain-containing protein 13 OS=Mus musculus GN=Abhd13 PE=2 SV=1 124 218 5.0E-10
sp|Q7ZVZ7|AB17C_DANRE Alpha/beta hydrolase domain-containing protein 17C OS=Danio rerio GN=abhd17c PE=2 SV=1 124 280 2.0E-09
sp|Q8XA81|YHFR_ECO57 Uncharacterized protein YfhR OS=Escherichia coli O157:H7 GN=yhfR PE=3 SV=4 124 324 3.0E-09
sp|P77538|YFHR_ECOLI Uncharacterized protein YfhR OS=Escherichia coli (strain K12) GN=yfhR PE=3 SV=4 124 324 3.0E-09
sp|Q5ZJX1|AB17C_CHICK Alpha/beta hydrolase domain-containing protein 17C OS=Gallus gallus GN=ABHD17C PE=2 SV=1 124 281 6.0E-09
sp|Q8VCV1|AB17C_MOUSE Alpha/beta hydrolase domain-containing protein 17C OS=Mus musculus GN=Abhd17c PE=1 SV=2 124 281 1.0E-08
sp|A5PKD9|AB17C_BOVIN Alpha/beta hydrolase domain-containing protein 17C OS=Bos taurus GN=ABHD17C PE=2 SV=1 124 281 1.0E-08
sp|Q6PCB6|AB17C_HUMAN Alpha/beta hydrolase domain-containing protein 17C OS=Homo sapiens GN=ABHD17C PE=2 SV=2 124 281 1.0E-08
sp|Q6GL10|AB17C_XENTR Alpha/beta hydrolase domain-containing protein 17C OS=Xenopus tropicalis GN=abhd17c PE=2 SV=1 124 281 4.0E-08
sp|Q2HJ19|AB17A_BOVIN Alpha/beta hydrolase domain-containing protein 17A OS=Bos taurus GN=ABHD17A PE=2 SV=1 121 227 4.0E-08
sp|Q7L211|ABHDD_HUMAN Alpha/beta hydrolase domain-containing protein 13 OS=Homo sapiens GN=ABHD13 PE=2 SV=1 124 218 4.0E-08
sp|Q99JW1|AB17A_MOUSE Alpha/beta hydrolase domain-containing protein 17A OS=Mus musculus GN=Abhd17a PE=1 SV=1 124 227 5.0E-08
sp|Q5XIJ5|AB17A_RAT Alpha/beta hydrolase domain-containing protein 17A OS=Rattus norvegicus GN=Abhd17a PE=2 SV=1 124 227 5.0E-08
sp|Q6DD70|AB17C_XENLA Alpha/beta hydrolase domain-containing protein 17C OS=Xenopus laevis GN=abhd17c PE=2 SV=1 124 281 6.0E-08
sp|P9WLC7|Y2307_MYCTU Uncharacterized protein Rv2307c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2307c PE=1 SV=1 124 237 7.0E-08
sp|P9WLC6|Y2307_MYCTO Uncharacterized protein MT2364 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2364 PE=4 SV=1 124 237 7.0E-08
sp|Q96GS6|AB17A_HUMAN Alpha/beta hydrolase domain-containing protein 17A OS=Homo sapiens GN=ABHD17A PE=1 SV=1 124 227 9.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 5 27 22
2 222 244 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9748
MAVPGLVWTVALLAVAPYAVYTVILGLLTTPVIQRHALYAHKINTLLWADVNRPETWGFASNQVTPFTLDTPDGE
SVYAWHITPLPLYLKNEARLTKQPLGLSSDFAQTESFRLLREDAEARLILYFHGNAGHIAQAVRPDTYHALTDTS
SYHLVAIDYRGFGHSTGVPSEDGLIQDASALVEWAINAAGISPDRIVLIGHSLGTAVVSGVAERYAVRGVEFAGI
VLVAGFSNLASLLSGYRIGGLIPLLGPFAAWPAFTKLLDRFVVDKWHSADRLANIVRHTKSRLRLSLVHAKNDRD
IPCTEDDVLFRSAVNESVSILDDDEFAAWKESRTVRKGEDAFVTTWTSEPDILVRQELFPYGAHDPIVGYAPVTL
AVMRSFDYQGTAYA*
Coding >Hirsu2|9748
ATGGCGGTGCCCGGCCTGGTTTGGACCGTGGCCCTCCTGGCCGTAGCGCCGTATGCCGTCTACACCGTCATCCTC
GGCCTCTTGACGACGCCCGTCATCCAGAGACACGCCCTGTACGCCCACAAGATCAACACCCTTCTCTGGGCCGAC
GTCAATCGGCCCGAGACGTGGGGATTCGCAAGCAATCAAGTGACGCCCTTTACCCTCGACACGCCCGACGGCGAG
AGCGTCTACGCCTGGCACATCACGCCCCTGCCGCTGTACCTGAAGAACGAGGCGAGGCTCACCAAGCAGCCCCTG
GGCCTTTCGTCCGACTTTGCCCAGACCGAGTCGTTCAGGCTCCTCAGGGAAGACGCCGAGGCGAGGCTGATTCTC
TACTTCCATGGCAACGCGGGCCACATCGCACAGGCTGTCCGCCCCGACACCTACCATGCCCTGACCGATACTTCG
TCGTATCACCTGGTGGCCATCGACTACCGCGGCTTCGGGCACTCGACCGGCGTCCCCAGTGAAGATGGCCTGATC
CAAGACGCCTCTGCCCTTGTAGAATGGGCCATCAACGCCGCCGGCATCTCGCCGGACCGCATCGTGCTGATCGGC
CACAGCCTCGGCACGGCCGTCGTGAGCGGCGTGGCGGAGAGGTACGCCGTCAGGGGCGTCGAGTTTGCCGGCATC
GTCCTGGTTGCCGGCTTCAGCAATCTTGCCTCCCTCCTGAGCGGGTACCGCATCGGAGGGCTGATTCCCCTGCTG
GGCCCGTTTGCCGCCTGGCCGGCCTTCACCAAGCTGCTCGACCGGTTCGTCGTCGACAAGTGGCACTCGGCAGAC
CGGCTGGCCAACATCGTCCGGCATACCAAGTCGAGGCTGCGTCTCAGCCTTGTCCACGCGAAGAACGACAGGGAC
ATCCCCTGCACCGAAGACGACGTGCTCTTCCGGTCCGCGGTGAACGAGAGCGTCAGCATCCTGGATGACGATGAG
TTTGCGGCGTGGAAGGAGAGTCGGACGGTGCGCAAGGGCGAGGACGCCTTCGTCACGACGTGGACCTCGGAGCCC
GACATCCTCGTCCGTCAAGAGCTGTTCCCGTACGGAGCTCACGATCCCATTGTGGGCTATGCGCCGGTCACGCTG
GCCGTCATGAGGTCCTTTGACTACCAGGGGACGGCCTATGCTTGA
Transcript >Hirsu2|9748
ATGGCGGTGCCCGGCCTGGTTTGGACCGTGGCCCTCCTGGCCGTAGCGCCGTATGCCGTCTACACCGTCATCCTC
GGCCTCTTGACGACGCCCGTCATCCAGAGACACGCCCTGTACGCCCACAAGATCAACACCCTTCTCTGGGCCGAC
GTCAATCGGCCCGAGACGTGGGGATTCGCAAGCAATCAAGTGACGCCCTTTACCCTCGACACGCCCGACGGCGAG
AGCGTCTACGCCTGGCACATCACGCCCCTGCCGCTGTACCTGAAGAACGAGGCGAGGCTCACCAAGCAGCCCCTG
GGCCTTTCGTCCGACTTTGCCCAGACCGAGTCGTTCAGGCTCCTCAGGGAAGACGCCGAGGCGAGGCTGATTCTC
TACTTCCATGGCAACGCGGGCCACATCGCACAGGCTGTCCGCCCCGACACCTACCATGCCCTGACCGATACTTCG
TCGTATCACCTGGTGGCCATCGACTACCGCGGCTTCGGGCACTCGACCGGCGTCCCCAGTGAAGATGGCCTGATC
CAAGACGCCTCTGCCCTTGTAGAATGGGCCATCAACGCCGCCGGCATCTCGCCGGACCGCATCGTGCTGATCGGC
CACAGCCTCGGCACGGCCGTCGTGAGCGGCGTGGCGGAGAGGTACGCCGTCAGGGGCGTCGAGTTTGCCGGCATC
GTCCTGGTTGCCGGCTTCAGCAATCTTGCCTCCCTCCTGAGCGGGTACCGCATCGGAGGGCTGATTCCCCTGCTG
GGCCCGTTTGCCGCCTGGCCGGCCTTCACCAAGCTGCTCGACCGGTTCGTCGTCGACAAGTGGCACTCGGCAGAC
CGGCTGGCCAACATCGTCCGGCATACCAAGTCGAGGCTGCGTCTCAGCCTTGTCCACGCGAAGAACGACAGGGAC
ATCCCCTGCACCGAAGACGACGTGCTCTTCCGGTCCGCGGTGAACGAGAGCGTCAGCATCCTGGATGACGATGAG
TTTGCGGCGTGGAAGGAGAGTCGGACGGTGCGCAAGGGCGAGGACGCCTTCGTCACGACGTGGACCTCGGAGCCC
GACATCCTCGTCCGTCAAGAGCTGTTCCCGTACGGAGCTCACGATCCCATTGTGGGCTATGCGCCGGTCACGCTG
GCCGTCATGAGGTCCTTTGACTACCAGGGGACGGCCTATGCTTGA
Gene >Hirsu2|9748
ATGGCGGTGCCCGGCCTGGTTTGGACCGTGGCCCTCCTGGCCGTAGCGCCGTATGCCGTCTACACCGTCATCCTC
GGCCTCTTGACGACGCCCGTCATCCAGAGACAGTGAGTCGATCGAGCCGCCGGCAGTGTGAAGCCGACGAGAGTC
TGACGCCGCCCGGACAGCGCCCTGTACGCCCACAAGATCAACACCCTTCTCTGGGCCGACGTCAATCGGCCCGAG
ACGTGGGGATTCGCAAGTTTGTCAATCCGTCTGCTCGCCTCGTGCCCTGGGCGGCCCCCGTTGACAGTCACACCG
CCACGACAGGCAATCAAGTGACGCCCTTTACCCTCGACACGCCCGACGGCGAGAGCGTCTACGCCTGGCACATCA
CGCCCCTGCCGCTGTACCTGAAGAACGAGGCGAGGCTCACCAAGCAGCCCCTGGGCCTTTCGTCCGACTTTGCCC
AGACCGAGTCGTTCAGGCTCCTCAGGGAAGACGCCGAGGCGAGGCTGATTCTCTACTGTACGCCGGAGCCTCTTC
TGGAACGCGTCCGACACGCCGTGAATGCTGACGAGGAGCAGTCCATGGCGTACGTCCCCTGCCATTGGTTGGCCT
TGTGCAGATGCTCACAACCGGTAGAACGCGGGCCACATCGCACAGGCTGTCCGCCCCGACACCTACCATGCCCTG
ACCGATACTTCGTCGTATCACCTGGTGGCCATCGACTACCGCGGCTTCGGGCACTCGACCGGCGTCCCCAGTGAA
GATGGCCTGATCCAAGACGCCTCTGCCCTTGTAGAATGGGCCATCAACGCCGCCGGCATCTCGCCGGACCGCATC
GTGCTGATCGGCCACAGCCTCGGCACGGCCGTCGTGAGCGGCGTGGCGGAGAGGTACGCCGTCAGGGGCGTCGAG
TTTGCCGGCATCGTCCTGGTTGCCGGCTTCAGCAATCTTGCCTCCCTCCTGAGCGGGTACCGCATCGGAGGGCTG
ATTCCCCTGCTGGGCCCGTTTGCCGCCTGGCCGGCCTTCACCAAGCTGCTCGACCGGTTCGTCGTCGACAAGTGG
CACTCGGCAGACCGGCTGGCCAACATCGTCCGGCATACCAAGTCGAGGCTGCGTCTCAGCCTTGTCCACGCGAAG
AACGACAGGGACATCCCCTGCACCGAAGACGACGTGCTCTTCCGGTCCGCGGTGAACGAGAGCGTCAGCATCCTG
GATGACGATGAGTTTGCGGCGTGGAAGGAGAGTCGGACGGTGCGCAAGGGCGAGGACGCCTTCGTCACGACGTGG
ACCTCGGAGCCCGACATCCTCGTCCGTCAAGAGCTGTTCCCGTACGGAGGTGAGTCAGGACTGGAGAGCGTAAGG
CCGCAACTCCCCGCGCTAACGGATCCAATTTCAGCTCACGATCCCATTGTGGGCTATGCGCCGGTCACGCTGGCC
GTCATGAGGTCCTTTGACTACCAGGGGACGGCCTATGCTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail