Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|974
Gene name
LocationContig_120:29983..32023
Strand-
Gene length (bp)2040
Transcript length (bp)1875
Coding sequence length (bp)1875
Protein length (aa) 625

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01061 ABC2_membrane ABC-2 type transporter 1.7E-25 348 556
PF00005 ABC_tran ABC transporter 1.4E-22 45 196

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8RWI9|AB15G_ARATH ABC transporter G family member 15 OS=Arabidopsis thaliana GN=ABCG15 PE=2 SV=2 21 622 2.0E-82
sp|Q9C8K2|AB12G_ARATH ABC transporter G family member 12 OS=Arabidopsis thaliana GN=ABCG12 PE=1 SV=1 21 622 2.0E-82
sp|Q8RXN0|AB11G_ARATH ABC transporter G family member 11 OS=Arabidopsis thaliana GN=ABCG11 PE=1 SV=1 21 582 3.0E-81
sp|Q9M2V5|AB18G_ARATH ABC transporter G family member 18 OS=Arabidopsis thaliana GN=ABCG18 PE=2 SV=1 35 556 8.0E-74
sp|Q9C8J8|AB13G_ARATH ABC transporter G family member 13 OS=Arabidopsis thaliana GN=ABCG13 PE=2 SV=1 21 622 9.0E-73
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8RWI9|AB15G_ARATH ABC transporter G family member 15 OS=Arabidopsis thaliana GN=ABCG15 PE=2 SV=2 21 622 2.0E-82
sp|Q9C8K2|AB12G_ARATH ABC transporter G family member 12 OS=Arabidopsis thaliana GN=ABCG12 PE=1 SV=1 21 622 2.0E-82
sp|Q8RXN0|AB11G_ARATH ABC transporter G family member 11 OS=Arabidopsis thaliana GN=ABCG11 PE=1 SV=1 21 582 3.0E-81
sp|Q9M2V5|AB18G_ARATH ABC transporter G family member 18 OS=Arabidopsis thaliana GN=ABCG18 PE=2 SV=1 35 556 8.0E-74
sp|Q9C8J8|AB13G_ARATH ABC transporter G family member 13 OS=Arabidopsis thaliana GN=ABCG13 PE=2 SV=1 21 622 9.0E-73
sp|O80946|AB1G_ARATH ABC transporter G family member 1 OS=Arabidopsis thaliana GN=ABCG1 PE=2 SV=1 39 557 2.0E-69
sp|Q9M3D6|AB19G_ARATH ABC transporter G family member 19 OS=Arabidopsis thaliana GN=ABCG19 PE=1 SV=1 28 587 3.0E-69
sp|Q9M2V6|AB17G_ARATH ABC transporter G family member 17 OS=Arabidopsis thaliana GN=ABCG17 PE=2 SV=1 39 587 7.0E-68
sp|Q55DA0|ABCGM_DICDI ABC transporter G family member 22 OS=Dictyostelium discoideum GN=abcG22 PE=2 SV=1 24 621 8.0E-68
sp|Q9M2V7|AB16G_ARATH ABC transporter G family member 16 OS=Arabidopsis thaliana GN=ABCG16 PE=2 SV=2 33 557 6.0E-67
sp|Q9SIT6|AB5G_ARATH ABC transporter G family member 5 OS=Arabidopsis thaliana GN=ABCG5 PE=2 SV=1 29 624 1.0E-66
sp|Q11180|WHT1_CAEEL ABC transporter ATP-binding protein/permease wht-1 OS=Caenorhabditis elegans GN=wht-1 PE=2 SV=2 38 623 4.0E-66
sp|Q9ZUT0|AB2G_ARATH ABC transporter G family member 2 OS=Arabidopsis thaliana GN=ABCG2 PE=2 SV=1 31 556 1.0E-65
sp|Q17320|WHITE_CERCA Protein white OS=Ceratitis capitata GN=W PE=2 SV=1 41 623 2.0E-65
sp|Q27256|WHITE_ANOGA Protein white OS=Anopheles gambiae GN=w PE=2 SV=1 35 623 1.0E-64
sp|Q8T685|ABCGC_DICDI ABC transporter G family member 12 OS=Dictyostelium discoideum GN=abcG12 PE=3 SV=1 42 621 1.0E-64
sp|Q9ZU35|AB7G_ARATH ABC transporter G family member 7 OS=Arabidopsis thaliana GN=ABCG7 PE=2 SV=1 4 593 3.0E-63
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 26 563 6.0E-63
sp|P10090|WHITE_DROME Protein white OS=Drosophila melanogaster GN=w PE=2 SV=2 22 623 6.0E-63
sp|Q9MAH4|AB10G_ARATH ABC transporter G family member 10 OS=Arabidopsis thaliana GN=ABCG10 PE=3 SV=1 38 622 7.0E-63
sp|Q05360|WHITE_LUCCU Protein white OS=Lucilia cuprina GN=W PE=2 SV=2 38 623 1.0E-62
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 21 621 1.0E-61
sp|Q9LFG8|AB20G_ARATH ABC transporter G family member 20 OS=Arabidopsis thaliana GN=ABCG20 PE=2 SV=1 41 556 2.0E-61
sp|Q9ZUU9|AB3G_ARATH ABC transporter G family member 3 OS=Arabidopsis thaliana GN=ABCG3 PE=1 SV=2 20 621 3.0E-61
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 26 563 3.0E-61
sp|Q3E9B8|AB23G_ARATH ABC transporter G family member 23 OS=Arabidopsis thaliana GN=ABCG23 PE=2 SV=1 43 624 5.0E-61
sp|Q9SW08|AB4G_ARATH ABC transporter G family member 4 OS=Arabidopsis thaliana GN=ABCG4 PE=3 SV=1 37 619 7.0E-61
sp|Q9FNB5|AB6G_ARATH ABC transporter G family member 6 OS=Arabidopsis thaliana GN=ABCG6 PE=2 SV=1 37 557 5.0E-60
sp|B8ALI0|AB5G_ORYSI ABC transporter G family member 5 OS=Oryza sativa subsp. indica GN=OsI_11044 PE=3 SV=1 40 570 3.0E-58
sp|Q8H8V7|AB5G_ORYSJ ABC transporter G family member 5 OS=Oryza sativa subsp. japonica GN=RCN1 PE=1 SV=1 40 570 4.0E-58
sp|Q9C6W5|AB14G_ARATH ABC transporter G family member 14 OS=Arabidopsis thaliana GN=ABCG14 PE=2 SV=1 41 620 8.0E-58
sp|Q86HQ2|ABCG8_DICDI ABC transporter G family member 8 OS=Dictyostelium discoideum GN=abcG8 PE=3 SV=1 26 606 1.0E-57
sp|P45843|SCRT_DROME Protein scarlet OS=Drosophila melanogaster GN=st PE=1 SV=3 20 622 3.0E-57
sp|Q9SZR9|AB9G_ARATH ABC transporter G family member 9 OS=Arabidopsis thaliana GN=ABCG9 PE=3 SV=2 27 469 4.0E-57
sp|Q9UNQ0|ABCG2_HUMAN ATP-binding cassette sub-family G member 2 OS=Homo sapiens GN=ABCG2 PE=1 SV=3 41 564 6.0E-57
sp|Q5MB13|ABCG2_MACMU ATP-binding cassette sub-family G member 2 OS=Macaca mulatta GN=ABCG2 PE=2 SV=1 41 564 6.0E-56
sp|Q16928|WHITE_ANOAL Protein white OS=Anopheles albimanus GN=W PE=3 SV=1 35 623 8.0E-56
sp|Q7TMS5|ABCG2_MOUSE ATP-binding cassette sub-family G member 2 OS=Mus musculus GN=Abcg2 PE=1 SV=1 41 564 1.0E-55
sp|Q7XA72|AB21G_ARATH ABC transporter G family member 21 OS=Arabidopsis thaliana GN=ABCG21 PE=2 SV=2 35 569 2.0E-55
sp|Q9FLX5|AB8G_ARATH ABC transporter G family member 8 OS=Arabidopsis thaliana GN=ABCG8 PE=2 SV=1 43 619 2.0E-54
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 26 619 5.0E-54
sp|Q9H221|ABCG8_HUMAN ATP-binding cassette sub-family G member 8 OS=Homo sapiens GN=ABCG8 PE=1 SV=1 44 561 1.0E-53
sp|Q9H222|ABCG5_HUMAN ATP-binding cassette sub-family G member 5 OS=Homo sapiens GN=ABCG5 PE=1 SV=1 41 566 3.0E-53
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 26 621 3.0E-53
sp|Q9FT51|AB27G_ARATH ABC transporter G family member 27 OS=Arabidopsis thaliana GN=ABCG27 PE=2 SV=1 26 620 2.0E-52
sp|Q09466|WHT3_CAEEL ABC transporter ATP-binding protein/permease wht-3 OS=Caenorhabditis elegans GN=wht-3 PE=3 SV=1 20 558 3.0E-52
sp|Q8T689|ABCG4_DICDI ABC transporter G family member 4 OS=Dictyostelium discoideum GN=abcG4 PE=3 SV=1 34 617 3.0E-52
sp|P58428|ABCG8_RAT ATP-binding cassette sub-family G member 8 OS=Rattus norvegicus GN=Abcg8 PE=2 SV=2 44 561 3.0E-52
sp|Q84TH5|AB25G_ARATH ABC transporter G family member 25 OS=Arabidopsis thaliana GN=ABCG25 PE=2 SV=1 32 620 7.0E-52
sp|Q8MIB3|ABCG2_PIG ATP-binding cassette sub-family G member 2 OS=Sus scrofa GN=ABCG2 PE=2 SV=1 41 564 1.0E-51
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 21 563 2.0E-51
sp|Q64343|ABCG1_MOUSE ATP-binding cassette sub-family G member 1 OS=Mus musculus GN=Abcg1 PE=1 SV=1 38 622 2.0E-51
sp|Q80W57|ABCG2_RAT ATP-binding cassette sub-family G member 2 OS=Rattus norvegicus GN=Abcg2 PE=1 SV=1 41 581 2.0E-51
sp|Q93YS4|AB22G_ARATH ABC transporter G family member 22 OS=Arabidopsis thaliana GN=ABCG22 PE=1 SV=1 21 620 2.0E-51
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 43 283 4.0E-51
sp|O42690|CDR3_CANAX Opaque-specific ABC transporter CDR3 OS=Candida albicans GN=CDR3 PE=2 SV=1 23 520 4.0E-51
sp|P45844|ABCG1_HUMAN ATP-binding cassette sub-family G member 1 OS=Homo sapiens GN=ABCG1 PE=1 SV=3 38 622 1.0E-50
sp|Q556W2|ABCGH_DICDI ABC transporter G family member 17 OS=Dictyostelium discoideum GN=abcG17-1 PE=3 SV=1 19 553 1.0E-50
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 21 621 5.0E-50
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 19 563 7.0E-50
sp|Q9H172|ABCG4_HUMAN ATP-binding cassette sub-family G member 4 OS=Homo sapiens GN=ABCG4 PE=1 SV=2 12 622 7.0E-50
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 38 577 1.0E-49
sp|Q4GZT4|ABCG2_BOVIN ATP-binding cassette sub-family G member 2 OS=Bos taurus GN=ABCG2 PE=3 SV=2 41 498 1.0E-49
sp|Q8T686|ABCG7_DICDI ABC transporter G family member 7 OS=Dictyostelium discoideum GN=abcG7 PE=3 SV=1 42 616 1.0E-49
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 32 536 1.0E-49
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 19 563 2.0E-49
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 19 554 2.0E-49
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 19 563 3.0E-49
sp|Q99PE7|ABCG5_RAT ATP-binding cassette sub-family G member 5 OS=Rattus norvegicus GN=Abcg5 PE=2 SV=3 41 599 4.0E-49
sp|P41820|BFR1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr1 PE=1 SV=1 22 552 6.0E-49
sp|Q99PE8|ABCG5_MOUSE ATP-binding cassette sub-family G member 5 OS=Mus musculus GN=Abcg5 PE=1 SV=1 41 599 7.0E-49
sp|Q9LK50|AB26G_ARATH ABC transporter G family member 26 OS=Arabidopsis thaliana GN=ABCG26 PE=3 SV=2 26 624 2.0E-48
sp|Q9DBM0|ABCG8_MOUSE ATP-binding cassette sub-family G member 8 OS=Mus musculus GN=Abcg8 PE=2 SV=1 44 561 3.0E-48
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 39 622 6.0E-48
sp|Q55GB1|ABCGF_DICDI ABC transporter G family member 15 OS=Dictyostelium discoideum GN=abcG15 PE=3 SV=1 40 539 7.0E-48
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 22 563 1.0E-47
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 19 563 2.0E-47
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 23 429 2.0E-47
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 23 410 2.0E-47
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 41 281 4.0E-47
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 23 429 5.0E-47
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 21 563 8.0E-46
sp|Q9SJK6|WBC30_ARATH Putative white-brown complex homolog protein 30 OS=Arabidopsis thaliana GN=WBC30 PE=1 SV=3 8 296 2.0E-45
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 42 556 5.0E-45
sp|P25371|ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADP1 PE=1 SV=2 8 306 6.0E-45
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 37 562 6.0E-45
sp|O81016|AB32G_ARATH ABC transporter G family member 32 OS=Arabidopsis thaliana GN=ABCG32 PE=1 SV=1 46 557 2.0E-44
sp|Q8S628|AB51G_ORYSJ ABC transporter G family member 51 OS=Oryza sativa subsp. japonica GN=ABCG51 PE=3 SV=1 35 557 3.0E-44
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 43 538 4.0E-44
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 43 538 6.0E-44
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 46 557 2.0E-43
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 43 598 2.0E-43
sp|Q8GU89|AB37G_ORYSJ ABC transporter G family member 37 OS=Oryza sativa subsp. japonica GN=ABCG37 PE=2 SV=1 43 536 5.0E-43
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 43 555 1.0E-42
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 42 556 3.0E-42
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 18 293 3.0E-42
sp|Q9ZUT8|AB33G_ARATH ABC transporter G family member 33 OS=Arabidopsis thaliana GN=ABCG33 PE=2 SV=1 30 556 3.0E-42
sp|Q8GU82|AB45G_ORYSJ ABC transporter G family member 45 OS=Oryza sativa subsp. japonica GN=ABCG45 PE=2 SV=2 43 560 4.0E-42
sp|Q0JLC5|AB36G_ORYSJ ABC transporter G family member 36 OS=Oryza sativa subsp. japonica GN=ABCG36 PE=2 SV=1 43 536 5.0E-42
sp|Q8GU84|AB48G_ORYSJ ABC transporter G family member 48 OS=Oryza sativa subsp. japonica GN=ABCG48 PE=3 SV=1 38 614 5.0E-42
sp|A2WSH0|AB36G_ORYSI ABC transporter G family member 36 OS=Oryza sativa subsp. indica GN=ABCG36 PE=2 SV=1 43 536 5.0E-42
sp|Q9MAG3|AB24G_ARATH ABC transporter G family member 24 OS=Arabidopsis thaliana GN=ABCG24 PE=2 SV=2 21 336 7.0E-42
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 43 526 8.0E-42
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 43 536 9.0E-42
sp|Q8LQX2|AB32G_ORYSJ ABC transporter G family member 32 OS=Oryza sativa subsp. japonica GN=ABCG32 PE=2 SV=1 43 536 1.0E-41
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 17 579 1.0E-41
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 38 556 2.0E-41
sp|Q9XIE2|AB36G_ARATH ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1 42 559 2.0E-41
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 42 559 3.0E-41
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 26 556 3.0E-41
sp|Q8GU88|AB39G_ORYSJ ABC transporter G family member 39 OS=Oryza sativa subsp. japonica GN=ABCG39 PE=3 SV=1 37 562 4.0E-41
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 36 614 4.0E-41
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 43 608 5.0E-41
sp|Q556W2|ABCGH_DICDI ABC transporter G family member 17 OS=Dictyostelium discoideum GN=abcG17-1 PE=3 SV=1 33 563 7.0E-41
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 17 564 8.0E-41
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 43 538 9.0E-41
sp|A3BXL8|AB53G_ORYSJ ABC transporter G family member 53 OS=Oryza sativa subsp. japonica GN=ABCG53 PE=2 SV=1 36 562 1.0E-40
sp|A3BXL8|AB53G_ORYSJ ABC transporter G family member 53 OS=Oryza sativa subsp. japonica GN=ABCG53 PE=2 SV=1 43 538 1.0E-40
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 35 603 1.0E-40
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 19 555 1.0E-40
sp|Q9XIE2|AB36G_ARATH ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1 33 526 2.0E-40
sp|Q2PCF1|PDR2_NICPL Pleiotropic drug resistance protein 2 OS=Nicotiana plumbaginifolia GN=PDR2 PE=2 SV=1 38 556 2.0E-40
sp|Q8GU86|AB43G_ORYSJ ABC transporter G family member 43 OS=Oryza sativa subsp. japonica GN=ABCG43 PE=2 SV=2 43 557 3.0E-40
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 43 538 4.0E-40
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 43 538 4.0E-40
sp|B9GDE5|AB50G_ORYSJ ABC transporter G family member 50 OS=Oryza sativa subsp. japonica GN=ABCG50 PE=2 SV=2 43 526 4.0E-40
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 43 607 5.0E-40
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 28 539 7.0E-40
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 42 555 9.0E-40
sp|Q8GU82|AB45G_ORYSJ ABC transporter G family member 45 OS=Oryza sativa subsp. japonica GN=ABCG45 PE=2 SV=2 38 556 1.0E-39
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 23 543 2.0E-39
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 37 618 3.0E-39
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 43 556 3.0E-39
sp|Q7PC80|AB34G_ORYSJ ABC transporter G family member 34 OS=Oryza sativa subsp. japonica GN=ABCG34 PE=3 SV=1 38 562 3.0E-39
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 43 611 5.0E-39
sp|Q8GZ52|AB30G_ARATH ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2 43 556 6.0E-39
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 8 566 7.0E-39
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 38 556 8.0E-39
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 43 538 1.0E-38
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 21 606 1.0E-38
sp|Q8GU84|AB48G_ORYSJ ABC transporter G family member 48 OS=Oryza sativa subsp. japonica GN=ABCG48 PE=3 SV=1 43 592 2.0E-38
sp|Q7PC82|AB42G_ARATH ABC transporter G family member 42 OS=Arabidopsis thaliana GN=ABCG42 PE=2 SV=1 36 556 2.0E-38
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 17 563 2.0E-38
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 36 562 3.0E-38
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 17 563 3.0E-38
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 39 483 4.0E-38
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 38 562 4.0E-38
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 43 556 5.0E-38
sp|Q99P81|ABCG3_MOUSE ATP-binding cassette sub-family G member 3 OS=Mus musculus GN=Abcg3 PE=1 SV=2 44 561 5.0E-38
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 21 287 7.0E-38
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 43 556 8.0E-38
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 43 591 9.0E-38
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 43 538 1.0E-37
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 43 563 1.0E-37
sp|Q0JLC5|AB36G_ORYSJ ABC transporter G family member 36 OS=Oryza sativa subsp. japonica GN=ABCG36 PE=2 SV=1 36 562 2.0E-37
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 43 556 2.0E-37
sp|Q7PC81|AB43G_ARATH ABC transporter G family member 43 OS=Arabidopsis thaliana GN=ABCG43 PE=3 SV=1 42 556 2.0E-37
sp|Q8GU89|AB37G_ORYSJ ABC transporter G family member 37 OS=Oryza sativa subsp. japonica GN=ABCG37 PE=2 SV=1 36 561 2.0E-37
sp|P41820|BFR1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr1 PE=1 SV=1 38 563 4.0E-37
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 23 538 5.0E-37
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 33 557 7.0E-37
sp|Q8GU85|AB40G_ORYSJ ABC transporter G family member 40 OS=Oryza sativa subsp. japonica GN=ABCG40 PE=3 SV=2 38 525 8.0E-37
sp|Q02785|PDR12_YEAST ATP-dependent permease PDR12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR12 PE=1 SV=1 41 283 8.0E-37
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 21 280 9.0E-37
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 41 538 9.0E-37
sp|A2WSH0|AB36G_ORYSI ABC transporter G family member 36 OS=Oryza sativa subsp. indica GN=ABCG36 PE=2 SV=1 36 562 1.0E-36
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 36 564 1.0E-36
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 43 526 1.0E-36
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 33 564 1.0E-36
sp|Q9ZUT8|AB33G_ARATH ABC transporter G family member 33 OS=Arabidopsis thaliana GN=ABCG33 PE=2 SV=1 26 526 1.0E-36
sp|Q08409|AUS1_YEAST ATP-dependent permease AUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUS1 PE=3 SV=1 21 547 2.0E-36
sp|P40550|PDR11_YEAST ATP-dependent permease PDR11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR11 PE=1 SV=3 21 591 2.0E-36
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 41 538 3.0E-36
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 26 526 4.0E-36
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 43 539 4.0E-36
sp|Q8LQX2|AB32G_ORYSJ ABC transporter G family member 32 OS=Oryza sativa subsp. japonica GN=ABCG32 PE=2 SV=1 38 562 5.0E-36
sp|Q8GU86|AB43G_ORYSJ ABC transporter G family member 43 OS=Oryza sativa subsp. japonica GN=ABCG43 PE=2 SV=2 38 603 5.0E-36
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 43 536 5.0E-36
sp|Q9FF46|AB28G_ARATH ABC transporter G family member 28 OS=Arabidopsis thaliana GN=ABCG28 PE=3 SV=1 21 281 6.0E-36
sp|O42690|CDR3_CANAX Opaque-specific ABC transporter CDR3 OS=Candida albicans GN=CDR3 PE=2 SV=1 33 608 1.0E-35
sp|Q7PC81|AB43G_ARATH ABC transporter G family member 43 OS=Arabidopsis thaliana GN=ABCG43 PE=3 SV=1 43 557 2.0E-35
sp|Q8GU85|AB40G_ORYSJ ABC transporter G family member 40 OS=Oryza sativa subsp. japonica GN=ABCG40 PE=3 SV=2 43 538 2.0E-35
sp|Q7PC83|AB41G_ARATH ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1 43 556 3.0E-35
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 43 556 6.0E-35
sp|O81016|AB32G_ARATH ABC transporter G family member 32 OS=Arabidopsis thaliana GN=ABCG32 PE=1 SV=1 42 525 6.0E-35
sp|Q7PC80|AB34G_ORYSJ ABC transporter G family member 34 OS=Oryza sativa subsp. japonica GN=ABCG34 PE=3 SV=1 43 536 7.0E-35
sp|Q8S628|AB51G_ORYSJ ABC transporter G family member 51 OS=Oryza sativa subsp. japonica GN=ABCG51 PE=3 SV=1 43 539 8.0E-35
sp|Q02785|PDR12_YEAST ATP-dependent permease PDR12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR12 PE=1 SV=1 40 611 1.0E-34
sp|B9GDE5|AB50G_ORYSJ ABC transporter G family member 50 OS=Oryza sativa subsp. japonica GN=ABCG50 PE=2 SV=2 1 556 2.0E-34
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 24 566 2.0E-34
sp|Q7PC83|AB41G_ARATH ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1 39 557 2.0E-34
sp|Q8GU88|AB39G_ORYSJ ABC transporter G family member 39 OS=Oryza sativa subsp. japonica GN=ABCG39 PE=3 SV=1 43 536 3.0E-34
sp|Q2PCF1|PDR2_NICPL Pleiotropic drug resistance protein 2 OS=Nicotiana plumbaginifolia GN=PDR2 PE=2 SV=1 43 538 8.0E-34
sp|Q8GZ52|AB30G_ARATH ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2 39 557 1.0E-33
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 43 563 1.0E-33
sp|Q7PC82|AB42G_ARATH ABC transporter G family member 42 OS=Arabidopsis thaliana GN=ABCG42 PE=2 SV=1 43 557 2.0E-33
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 43 526 4.0E-33
sp|C7J6G6|AB46G_ORYSJ ABC transporter G family member 46 OS=Oryza sativa subsp. japonica GN=ABCG46 PE=3 SV=2 43 538 1.0E-32
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 43 563 1.0E-32
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 59 590 2.0E-31
sp|Q55GB1|ABCGF_DICDI ABC transporter G family member 15 OS=Dictyostelium discoideum GN=abcG15 PE=3 SV=1 43 563 7.0E-31
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 36 556 8.0E-31
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 42 563 2.0E-30
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 30 623 5.0E-30
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 43 564 1.0E-29
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 59 563 6.0E-29
sp|C7J6G6|AB46G_ORYSJ ABC transporter G family member 46 OS=Oryza sativa subsp. japonica GN=ABCG46 PE=3 SV=2 24 562 1.0E-28
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 13 622 3.0E-28
sp|Q9C0Y5|PDR1_SCHPO ATP-binding cassette transporter pdr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdr1 PE=3 SV=1 1 282 9.0E-27
sp|P12428|BROWN_DROME Protein brown OS=Drosophila melanogaster GN=bw PE=2 SV=1 21 219 3.0E-24
sp|Q7VM95|METN_HAEDU Methionine import ATP-binding protein MetN OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=metN PE=3 SV=1 44 256 3.0E-24
sp|Q24739|BROWN_DROVI Protein brown OS=Drosophila virilis GN=bw PE=2 SV=1 43 219 5.0E-24
sp|Q0I5E9|METN_HAES1 Methionine import ATP-binding protein MetN OS=Haemophilus somnus (strain 129Pt) GN=metN PE=3 SV=1 42 288 2.0E-21
sp|O65934|ABC1_MYCTU ABC transporter ATP-binding/permease protein Rv1747 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1747 PE=1 SV=1 11 251 3.0E-21
sp|Q8SQU5|YBD4_ENCCU ABC transporter-like protein ECU11_1340 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU11_1340 PE=1 SV=1 20 301 9.0E-21
sp|Q73EL7|METN2_BACC1 Methionine import ATP-binding protein MetN 2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=metN2 PE=3 SV=1 44 287 1.0E-20
sp|Q58903|Y1508_METJA Uncharacterized ABC transporter ATP-binding protein MJ1508 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1508 PE=3 SV=1 41 227 1.0E-20
sp|Q81ZF5|METN2_BACAN Methionine import ATP-binding protein MetN 2 OS=Bacillus anthracis GN=metN2 PE=3 SV=1 44 287 2.0E-20
sp|Q7NX01|CYSA1_CHRVO Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=cysA1 PE=3 SV=1 54 256 2.0E-20
sp|Q7VZE5|CYSA_BORPE Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cysA PE=3 SV=1 44 258 2.0E-20
sp|Q9X196|POTA_THEMA Spermidine/putrescine import ATP-binding protein PotA OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=potA PE=3 SV=1 43 258 2.0E-20
sp|Q9C0Y5|PDR1_SCHPO ATP-binding cassette transporter pdr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdr1 PE=3 SV=1 28 563 3.0E-20
sp|Q7W9U5|CYSA_BORPA Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=cysA PE=3 SV=1 44 258 3.0E-20
sp|Q18KE1|PHNC1_HALWD Phosphonates import ATP-binding protein PhnC 1 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=phnC1 PE=3 SV=1 44 227 3.0E-20
sp|Q7WGW1|CYSA_BORBR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=cysA PE=3 SV=1 44 258 3.0E-20
sp|Q63GR8|METN2_BACCZ Methionine import ATP-binding protein MetN 2 OS=Bacillus cereus (strain ZK / E33L) GN=metN2 PE=3 SV=1 44 287 3.0E-20
sp|Q6D3Q6|METN2_PECAS Methionine import ATP-binding protein MetN 2 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=metN2 PE=3 SV=1 44 256 4.0E-20
sp|Q6HP89|METN1_BACHK Methionine import ATP-binding protein MetN 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=metN1 PE=3 SV=1 44 287 4.0E-20
sp|P44785|METN_HAEIN Methionine import ATP-binding protein MetN OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=metN PE=3 SV=1 42 256 4.0E-20
sp|Q9G4F5|CYSA_CUCSA Sulfate/thiosulfate import ATP-binding protein cysA OS=Cucumis sativus GN=CYSA PE=3 SV=1 26 258 4.0E-20
sp|Q81IN8|METN2_BACCR Methionine import ATP-binding protein MetN 2 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=metN2 PE=3 SV=1 44 287 4.0E-20
sp|Q4QMH4|METN_HAEI8 Methionine import ATP-binding protein MetN OS=Haemophilus influenzae (strain 86-028NP) GN=metN PE=3 SV=1 42 256 6.0E-20
sp|Q928L8|METN2_LISIN Methionine import ATP-binding protein MetN 2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=metN2 PE=3 SV=1 44 288 2.0E-19
sp|O34979|YVRO_BACSU Uncharacterized ABC transporter ATP-binding protein YvrO OS=Bacillus subtilis (strain 168) GN=yvrO PE=3 SV=2 43 229 2.0E-19
sp|Q2JB14|PHNC_FRASC Phosphonates import ATP-binding protein PhnC OS=Frankia sp. (strain CcI3) GN=phnC PE=3 SV=1 44 256 2.0E-19
sp|Q8NSN2|METN_CORGL Methionine import ATP-binding protein MetN OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=metN PE=3 SV=1 3 256 3.0E-19
sp|Q8Z4V6|CYSA_SALTI Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhi GN=cysA PE=3 SV=1 43 246 3.0E-19
sp|P55662|Y4TH_RHISN Probable amino-acid ABC transporter ATP-binding protein y4tH OS=Rhizobium sp. (strain NGR234) GN=NGR_a01510 PE=3 SV=1 27 277 3.0E-19
sp|P40860|CYSA_SALTY Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysA PE=3 SV=2 43 246 3.0E-19
sp|P74548|CYSA_SYNY3 Sulfate/thiosulfate import ATP-binding protein CysA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cysA PE=3 SV=1 42 259 4.0E-19
sp|Q89UD2|CYSA_BRADU Sulfate/thiosulfate import ATP-binding protein CysA OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=cysA PE=3 SV=1 44 258 4.0E-19
sp|Q8Y4L8|METN2_LISMO Methionine import ATP-binding protein MetN 2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=metN2 PE=3 SV=1 44 288 4.0E-19
sp|Q5WKL3|METN1_BACSK Methionine import ATP-binding protein MetN 1 OS=Bacillus clausii (strain KSM-K16) GN=metN1 PE=3 SV=1 21 253 4.0E-19
sp|O34697|BCEA_BACSU Bacitracin export ATP-binding protein BceA OS=Bacillus subtilis (strain 168) GN=bceA PE=2 SV=1 41 233 5.0E-19
sp|Q839D4|ECFA2_ENTFA Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=ecfA2 PE=3 SV=2 46 302 5.0E-19
sp|Q8PNN4|CYSA_XANAC Sulfate/thiosulfate import ATP-binding protein CysA OS=Xanthomonas axonopodis pv. citri (strain 306) GN=cysA PE=3 SV=2 38 246 5.0E-19
sp|Q667L9|METN2_YERPS Methionine import ATP-binding protein MetN 2 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=metN2 PE=3 SV=1 42 290 6.0E-19
sp|Q8G5P8|METN_BIFLO Methionine import ATP-binding protein MetN OS=Bifidobacterium longum (strain NCC 2705) GN=metN PE=3 SV=1 21 305 6.0E-19
sp|Q5X627|POTA_LEGPA Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila (strain Paris) GN=potA PE=3 SV=1 43 258 7.0E-19
sp|Q8UA73|CYSA2_AGRFC Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysA2 PE=3 SV=1 51 245 7.0E-19
sp|Q6NBT1|CYSA_RHOPA Sulfate/thiosulfate import ATP-binding protein CysA OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=cysA PE=3 SV=1 44 258 7.0E-19
sp|P40550|PDR11_YEAST ATP-dependent permease PDR11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR11 PE=1 SV=3 19 563 9.0E-19
sp|Q6D201|CYSA_PECAS Sulfate/thiosulfate import ATP-binding protein CysA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=cysA PE=3 SV=1 26 259 9.0E-19
sp|Q1CFH7|METN2_YERPN Methionine import ATP-binding protein MetN 2 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=metN2 PE=3 SV=1 51 290 1.0E-18
sp|Q8ZH38|METN1_YERPE Methionine import ATP-binding protein MetN 1 OS=Yersinia pestis GN=metN1 PE=3 SV=1 51 290 1.0E-18
sp|Q1CAK4|METN1_YERPA Methionine import ATP-binding protein MetN 1 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=metN1 PE=3 SV=1 51 290 1.0E-18
sp|Q9I6L0|CYSA_PSEAE Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysA PE=3 SV=1 26 258 1.0E-18
sp|Q65VG9|METN_MANSM Methionine import ATP-binding protein MetN OS=Mannheimia succiniciproducens (strain MBEL55E) GN=metN PE=3 SV=1 44 288 1.0E-18
sp|Q04G50|POTA_OENOB Spermidine/putrescine import ATP-binding protein PotA OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=potA PE=3 SV=2 43 256 1.0E-18
sp|Q24XJ2|POTA_DESHY Spermidine/putrescine import ATP-binding protein PotA OS=Desulfitobacterium hafniense (strain Y51) GN=potA PE=3 SV=2 43 279 1.0E-18
sp|Q5ZWE4|POTA_LEGPH Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=potA PE=3 SV=2 43 258 1.0E-18
sp|P94374|YXLF_BACSU Uncharacterized ABC transporter ATP-binding protein YxlF OS=Bacillus subtilis (strain 168) GN=yxlF PE=2 SV=1 44 251 2.0E-18
sp|Q88AS5|CYSA_PSESM Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cysA PE=3 SV=1 26 258 2.0E-18
sp|Q5E715|METN_VIBF1 Methionine import ATP-binding protein MetN OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=metN PE=3 SV=2 37 288 2.0E-18
sp|Q8FRX8|METN_COREF Methionine import ATP-binding protein MetN OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=metN PE=3 SV=1 3 256 2.0E-18
sp|P9WQM1|CYSA_MYCTU Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cysA PE=1 SV=2 44 256 2.0E-18
sp|P9WQM0|CYSA_MYCTO Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cysA PE=3 SV=2 44 256 2.0E-18
sp|P0A4W3|CYSA_MYCBO Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cysA PE=3 SV=2 44 256 2.0E-18
sp|Q8E8K8|CYSA2_SHEON Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Shewanella oneidensis (strain MR-1) GN=cysA2 PE=3 SV=1 44 256 2.0E-18
sp|Q47JR8|MSBA_DECAR Lipid A export ATP-binding/permease protein MsbA OS=Dechloromonas aromatica (strain RCB) GN=msbA PE=3 SV=1 1 252 2.0E-18
sp|Q08409|AUS1_YEAST ATP-dependent permease AUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUS1 PE=3 SV=1 52 285 3.0E-18
sp|Q8UH62|CYSA1_AGRFC Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysA1 PE=3 SV=2 44 256 3.0E-18
sp|P37774|YECC_ECOLI L-cystine transport system ATP-binding protein YecC OS=Escherichia coli (strain K12) GN=yecC PE=3 SV=2 41 252 3.0E-18
sp|Q4KKK8|METN1_PSEF5 Methionine import ATP-binding protein MetN 1 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=metN1 PE=3 SV=1 51 289 3.0E-18
sp|Q4L5B3|POTA_STAHJ Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=potA PE=3 SV=1 21 256 3.0E-18
sp|O31339|CYSA_BACC1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cysA PE=3 SV=2 51 258 3.0E-18
sp|Q24QI5|METN_DESHY Methionine import ATP-binding protein MetN OS=Desulfitobacterium hafniense (strain Y51) GN=metN PE=3 SV=1 44 227 3.0E-18
sp|Q7AH43|FBPC_ECO57 Fe(3+) ions import ATP-binding protein FbpC OS=Escherichia coli O157:H7 GN=fbpC PE=3 SV=2 41 256 3.0E-18
sp|Q8A883|POTA_BACTN Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=potA PE=3 SV=1 41 289 3.0E-18
sp|Q5L222|POTA_GEOKA Spermidine/putrescine import ATP-binding protein PotA OS=Geobacillus kaustophilus (strain HTA426) GN=potA PE=3 SV=1 42 286 3.0E-18
sp|Q17VE0|METN_HELAH Methionine import ATP-binding protein MetN OS=Helicobacter acinonychis (strain Sheeba) GN=metN PE=3 SV=1 36 256 3.0E-18
sp|Q03A07|METN_LACC3 Methionine import ATP-binding protein MetN OS=Lactobacillus casei (strain ATCC 334) GN=metN PE=3 SV=1 44 299 5.0E-18
sp|P96063|PHNT_SALTY Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=phnT PE=2 SV=1 13 277 5.0E-18
sp|Q71X09|METN2_LISMF Methionine import ATP-binding protein MetN 2 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=metN2 PE=3 SV=1 44 288 5.0E-18
sp|Q8XBJ8|CYSA_ECO57 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O157:H7 GN=cysA PE=3 SV=1 43 246 5.0E-18
sp|Q6F9A8|CYSA_ACIAD Sulfate/thiosulfate import ATP-binding protein CysA OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=cysA PE=3 SV=1 54 258 5.0E-18
sp|Q8FFB3|CYSA_ECOL6 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysA PE=3 SV=1 43 246 5.0E-18
sp|P16676|CYSA_ECOLI Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli (strain K12) GN=cysA PE=3 SV=2 43 246 5.0E-18
sp|Q6D734|FBPC1_PECAS Fe(3+) ions import ATP-binding protein FbpC 1 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=fbpC1 PE=3 SV=1 41 252 5.0E-18
sp|Q8KFD6|Y391_CHLTE Putative ABC transporter ATP-binding protein CT0391 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=CT0391 PE=3 SV=1 44 278 6.0E-18
sp|Q3K506|SSUB_PSEPF Aliphatic sulfonates import ATP-binding protein SsuB OS=Pseudomonas fluorescens (strain Pf0-1) GN=ssuB PE=3 SV=1 24 247 6.0E-18
sp|Q832Y6|METN1_ENTFA Methionine import ATP-binding protein MetN 1 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=metN1 PE=3 SV=1 21 227 7.0E-18
sp|O59479|Y1815_PYRHO Putative ABC transporter ATP-binding protein PH1815 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH1815 PE=3 SV=1 51 299 7.0E-18
sp|Q2S3A3|LOLD_SALRD Lipoprotein-releasing system ATP-binding protein LolD OS=Salinibacter ruber (strain DSM 13855 / M31) GN=lolD PE=3 SV=1 26 257 7.0E-18
sp|Q7VI92|METN_HELHP Methionine import ATP-binding protein MetN OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=metN PE=3 SV=1 46 256 8.0E-18
sp|Q5WXF0|POTA_LEGPL Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila (strain Lens) GN=potA PE=3 SV=1 43 258 8.0E-18
sp|Q5PCG9|METN2_SALPA Methionine import ATP-binding protein MetN 2 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=metN2 PE=3 SV=1 44 256 8.0E-18
sp|Q2SJY7|POTA_HAHCH Spermidine/putrescine import ATP-binding protein PotA OS=Hahella chejuensis (strain KCTC 2396) GN=potA PE=3 SV=1 51 287 9.0E-18
sp|P47705|Y467_MYCGE Putative ABC transporter ATP-binding protein MG467 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG467 PE=3 SV=1 24 246 9.0E-18
sp|Q9RYZ3|PSTB_DEIRA Phosphate import ATP-binding protein PstB OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=pstB PE=3 SV=1 41 247 9.0E-18
sp|Q57SD6|PHNT_SALCH Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella choleraesuis (strain SC-B67) GN=phnT PE=3 SV=1 13 245 1.0E-17
sp|Q9K876|CYSA_BACHD Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=cysA PE=3 SV=1 51 258 1.0E-17
sp|A0KMJ3|MACB2_AERHH Macrolide export ATP-binding/permease protein MacB 2 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=macB2 PE=3 SV=1 30 248 1.0E-17
sp|Q93DX8|CYSA_BURCE Sulfate/thiosulfate import ATP-binding protein CysA (Fragment) OS=Burkholderia cepacia GN=cysA PE=3 SV=1 42 266 1.0E-17
sp|Q6LN52|METN_PHOPR Methionine import ATP-binding protein MetN OS=Photobacterium profundum GN=metN PE=3 SV=2 46 256 1.0E-17
sp|Q8Z8W8|PHNT_SALTI Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella typhi GN=phnT PE=3 SV=1 13 245 1.0E-17
sp|Q9YG51|PSTB_AERPE Phosphate import ATP-binding protein PstB OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pstB PE=3 SV=1 41 277 1.0E-17
sp|Q1J6Q6|POTA_STRPF Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=potA PE=3 SV=1 43 256 1.0E-17
sp|Q1JGY7|POTA_STRPD Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=potA PE=3 SV=1 43 256 1.0E-17
sp|Q1JLT7|POTA_STRPC Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=potA PE=3 SV=1 43 256 1.0E-17
sp|Q1JBV6|POTA_STRPB Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=potA PE=3 SV=1 43 256 1.0E-17
sp|Q4ZZR8|METN1_PSEU2 Methionine import ATP-binding protein MetN 1 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=metN1 PE=3 SV=1 51 289 1.0E-17
sp|Q88RL5|METN1_PSEPK Methionine import ATP-binding protein MetN 1 OS=Pseudomonas putida (strain KT2440) GN=metN1 PE=3 SV=1 51 289 1.0E-17
sp|Q9CK97|METN_PASMU Methionine import ATP-binding protein MetN OS=Pasteurella multocida (strain Pm70) GN=metN PE=3 SV=1 42 256 1.0E-17
sp|Q03AH0|POTA_LACC3 Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus casei (strain ATCC 334) GN=potA PE=3 SV=1 51 256 2.0E-17
sp|Q8PC11|CYSA_XANCP Sulfate/thiosulfate import ATP-binding protein CysA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=cysA PE=3 SV=1 42 246 2.0E-17
sp|Q49WM4|POTA_STAS1 Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=potA PE=3 SV=1 43 256 2.0E-17
sp|Q1WSB9|ECFA2_LACS1 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Lactobacillus salivarius (strain UCC118) GN=ecfA2 PE=3 SV=1 51 246 2.0E-17
sp|Q5PID0|METN1_SALPA Methionine import ATP-binding protein MetN 1 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=metN1 PE=3 SV=1 44 288 2.0E-17
sp|P0CZ35|POTA_STRPQ Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=potA PE=3 SV=1 43 256 2.0E-17
sp|Q48TP4|POTA_STRPM Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=potA PE=3 SV=1 43 256 2.0E-17
sp|P0CZ34|POTA_STRP3 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=potA PE=3 SV=1 43 256 2.0E-17
sp|Q7UC29|CYSA_SHIFL Sulfate/thiosulfate import ATP-binding protein CysA OS=Shigella flexneri GN=cysA PE=3 SV=1 43 256 2.0E-17
sp|Q7CN92|POTA_STRP8 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=potA PE=3 SV=1 43 256 2.0E-17
sp|Q99ZS8|POTA_STRP1 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M1 GN=potA PE=3 SV=1 43 256 2.0E-17
sp|Q74K65|POTA_LACJO Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=potA PE=3 SV=1 46 256 2.0E-17
sp|Q8EPK1|METN1_OCEIH Methionine import ATP-binding protein MetN 1 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=metN1 PE=3 SV=2 44 256 2.0E-17
sp|Q5XCA4|POTA_STRP6 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=potA PE=3 SV=1 43 256 2.0E-17
sp|Q88R93|SSUB_PSEPK Aliphatic sulfonates import ATP-binding protein SsuB OS=Pseudomonas putida (strain KT2440) GN=ssuB PE=3 SV=1 41 246 2.0E-17
sp|Q972J5|Y1136_SULTO Putative ABC transporter ATP-binding protein STK_11360 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_11360 PE=3 SV=1 46 279 2.0E-17
sp|Q8Z990|METN1_SALTI Methionine import ATP-binding protein MetN 1 OS=Salmonella typhi GN=metN1 PE=3 SV=1 44 288 3.0E-17
sp|Q8Z8R5|METN2_SALTI Methionine import ATP-binding protein MetN 2 OS=Salmonella typhi GN=metN2 PE=3 SV=1 44 256 3.0E-17
sp|Q609Q1|CYSA_METCA Sulfate/thiosulfate import ATP-binding protein CysA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=cysA PE=3 SV=1 44 259 3.0E-17
sp|Q0AU85|METN_SYNWW Methionine import ATP-binding protein MetN OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=metN PE=3 SV=1 51 226 3.0E-17
sp|Q03PF2|POTA_LACBA Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=potA PE=3 SV=1 41 262 4.0E-17
sp|Q81GU1|CYSA_BACCR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cysA PE=3 SV=1 51 258 4.0E-17
sp|Q8ZR89|METN2_SALTY Methionine import ATP-binding protein MetN 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=metN2 PE=3 SV=1 44 256 4.0E-17
sp|Q9V1Q4|Y373_PYRAB Putative ABC transporter ATP-binding protein PYRAB03730 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB03730 PE=3 SV=1 51 271 4.0E-17
sp|Q88CL2|CYSA_PSEPK Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas putida (strain KT2440) GN=cysA PE=3 SV=1 46 256 4.0E-17
sp|Q6D1C4|METN3_PECAS Methionine import ATP-binding protein MetN 3 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=metN3 PE=3 SV=1 51 288 4.0E-17
sp|Q5PFQ7|PHNT_SALPA Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=phnT PE=3 SV=1 13 245 4.0E-17
sp|Q7M8M4|PHNC_WOLSU Phosphonates import ATP-binding protein PhnC OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=phnC PE=3 SV=1 51 258 4.0E-17
sp|Q64SQ6|POTA_BACFR Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides fragilis (strain YCH46) GN=potA PE=3 SV=2 41 256 4.0E-17
sp|Q57S53|METN2_SALCH Methionine import ATP-binding protein MetN 2 OS=Salmonella choleraesuis (strain SC-B67) GN=metN2 PE=3 SV=1 44 256 4.0E-17
sp|Q8R7Y5|ECFA2_CALS4 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=ecfA2 PE=1 SV=1 51 269 4.0E-17
sp|Q8RFN2|METN_FUSNN Methionine import ATP-binding protein MetN OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=metN PE=3 SV=1 44 256 5.0E-17
sp|Q57T09|METN1_SALCH Methionine import ATP-binding protein MetN 1 OS=Salmonella choleraesuis (strain SC-B67) GN=metN1 PE=3 SV=2 44 288 5.0E-17
sp|Q8ZRM9|METN1_SALTY Methionine import ATP-binding protein MetN 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=metN1 PE=3 SV=1 44 288 5.0E-17
sp|Q1IGL4|SSUB_PSEE4 Aliphatic sulfonates import ATP-binding protein SsuB OS=Pseudomonas entomophila (strain L48) GN=ssuB PE=3 SV=1 24 245 5.0E-17
sp|Q5LBT4|POTA_BACFN Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=potA PE=3 SV=1 41 256 5.0E-17
sp|Q82WT5|CYSA_NITEU Sulfate/thiosulfate import ATP-binding protein CysA OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=cysA PE=3 SV=1 42 258 6.0E-17
sp|Q042G7|POTA_LACGA Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=potA PE=3 SV=2 46 256 6.0E-17
sp|A3DJK5|ECFA2_CLOTH Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=ecfA2 PE=3 SV=1 41 269 6.0E-17
sp|Q87UN4|METN2_PSESM Methionine import ATP-binding protein MetN 2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=metN2 PE=3 SV=1 51 289 6.0E-17
sp|Q9CMG7|MSBA_PASMU Lipid A export ATP-binding/permease protein MsbA OS=Pasteurella multocida (strain Pm70) GN=msbA PE=3 SV=1 1 252 6.0E-17
sp|P46903|NATA_BACSU ABC transporter ATP-binding protein NatA OS=Bacillus subtilis (strain 168) GN=natA PE=1 SV=1 33 258 7.0E-17
sp|Q4L8L7|HRTA_STAHJ Putative hemin import ATP-binding protein HrtA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=hrtA PE=3 SV=1 43 246 7.0E-17
sp|Q665B6|SSUB_YERPS Aliphatic sulfonates import ATP-binding protein SsuB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=ssuB PE=3 SV=1 41 246 7.0E-17
sp|P63354|CYSA_BRUSU Sulfate/thiosulfate import ATP-binding protein CysA OS=Brucella suis biovar 1 (strain 1330) GN=cysA PE=3 SV=1 46 256 7.0E-17
sp|P63353|CYSA_BRUME Sulfate/thiosulfate import ATP-binding protein CysA OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=cysA PE=3 SV=1 46 256 7.0E-17
sp|Q668K6|CYSA_YERPS Sulfate/thiosulfate import ATP-binding protein CysA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cysA PE=3 SV=1 43 256 8.0E-17
sp|Q1CDR0|SSUB_YERPN Aliphatic sulfonates import ATP-binding protein SsuB OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=ssuB PE=3 SV=1 41 246 8.0E-17
sp|Q74PI5|SSUB_YERPE Aliphatic sulfonates import ATP-binding protein SsuB OS=Yersinia pestis GN=ssuB PE=3 SV=1 41 246 8.0E-17
sp|Q1C1S0|SSUB_YERPA Aliphatic sulfonates import ATP-binding protein SsuB OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=ssuB PE=3 SV=1 41 246 8.0E-17
sp|Q3IM24|PHNC2_NATPD Phosphonates import ATP-binding protein PhnC 2 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=phnC2 PE=3 SV=1 44 261 8.0E-17
sp|Q4UMZ7|LOLD_RICFE Lipoprotein-releasing system ATP-binding protein LolD OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=lolD PE=3 SV=1 37 245 8.0E-17
sp|Q87AL9|METN_XYLFT Methionine import ATP-binding protein MetN OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=metN PE=3 SV=1 51 299 9.0E-17
sp|Q6NJ07|METN_CORDI Methionine import ATP-binding protein MetN OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=metN PE=3 SV=1 21 256 9.0E-17
sp|Q58488|ECFA_METJA Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ecfA PE=3 SV=1 51 277 9.0E-17
sp|Q0BMC9|METN_FRATO Methionine import ATP-binding protein MetN OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=metN PE=3 SV=1 43 256 9.0E-17
sp|Q2A3Z2|METN_FRATH Methionine import ATP-binding protein MetN OS=Francisella tularensis subsp. holarctica (strain LVS) GN=metN PE=3 SV=1 43 256 9.0E-17
sp|Q31DV4|PHNC_THICR Phosphonates import ATP-binding protein PhnC OS=Thiomicrospira crunogena (strain XCL-2) GN=phnC PE=3 SV=1 44 258 9.0E-17
sp|Q72AQ6|PHNC_DESVH Phosphonates import ATP-binding protein PhnC OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=phnC PE=3 SV=1 41 226 1.0E-16
sp|Q1J0N0|PSTB_DEIGD Phosphate import ATP-binding protein PstB OS=Deinococcus geothermalis (strain DSM 11300) GN=pstB PE=3 SV=1 41 250 1.0E-16
sp|Q67JX4|ECFA2_SYMTH Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=ecfA2 PE=3 SV=1 44 279 1.0E-16
sp|Q20ZP0|PHNC1_RHOPB Phosphonates import ATP-binding protein PhnC 1 OS=Rhodopseudomonas palustris (strain BisB18) GN=phnC1 PE=3 SV=1 51 226 1.0E-16
sp|Q3A9G5|METN_CARHZ Methionine import ATP-binding protein MetN OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=metN PE=3 SV=1 44 256 1.0E-16
sp|Q7ULB5|MACB_RHOBA Macrolide export ATP-binding/permease protein MacB OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=macB PE=3 SV=1 34 226 1.0E-16
sp|Q8XXB6|MSBA_RALSO Lipid A export ATP-binding/permease protein MsbA OS=Ralstonia solanacearum (strain GMI1000) GN=msbA PE=3 SV=1 44 246 1.0E-16
sp|P75110|Y683_MYCPN Putative ABC transporter ATP-binding protein MG467 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_683 PE=3 SV=1 35 246 1.0E-16
sp|Q1BWI2|NODI_BURCA Nod factor export ATP-binding protein I OS=Burkholderia cenocepacia (strain AU 1054) GN=nodI PE=3 SV=1 41 252 1.0E-16
sp|Q8ELR4|POTA_OCEIH Spermidine/putrescine import ATP-binding protein PotA OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=potA PE=3 SV=1 43 256 1.0E-16
sp|A0PXX8|ECFA2_CLONN Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium novyi (strain NT) GN=ecfA2 PE=3 SV=1 44 269 1.0E-16
sp|Q63TY1|CYSA_BURPS Sulfate/thiosulfate import ATP-binding protein CysA OS=Burkholderia pseudomallei (strain K96243) GN=cysA PE=3 SV=1 28 277 1.0E-16
sp|P37009|FBPC_ECOLI Fe(3+) ions import ATP-binding protein FbpC OS=Escherichia coli (strain K12) GN=fbpC PE=3 SV=3 41 256 1.0E-16
sp|Q7N6Z2|CYSA_PHOLL Sulfate/thiosulfate import ATP-binding protein CysA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cysA PE=3 SV=1 43 259 1.0E-16
sp|Q8F6Z1|CYSA_LEPIN Sulfate/thiosulfate import ATP-binding protein CysA OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=cysA PE=3 SV=2 42 259 1.0E-16
sp|Q72PE5|CYSA_LEPIC Sulfate/thiosulfate import ATP-binding protein CysA OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=cysA PE=3 SV=1 42 259 1.0E-16
sp|Q62K82|CYSA_BURMA Sulfate/thiosulfate import ATP-binding protein CysA OS=Burkholderia mallei (strain ATCC 23344) GN=cysA PE=3 SV=1 28 277 1.0E-16
sp|Q1CGD7|MACB2_YERPN Macrolide export ATP-binding/permease protein MacB 2 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=macB2 PE=3 SV=1 30 229 1.0E-16
sp|Q66CL2|MACB1_YERPS Macrolide export ATP-binding/permease protein MacB 1 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=macB1 PE=3 SV=1 30 229 1.0E-16
sp|Q7CHI2|MACB1_YERPE Macrolide export ATP-binding/permease protein MacB 1 OS=Yersinia pestis GN=macB1 PE=3 SV=1 30 229 1.0E-16
sp|Q1CA99|MACB1_YERPA Macrolide export ATP-binding/permease protein MacB 1 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=macB1 PE=3 SV=1 30 229 1.0E-16
sp|Q8D0W8|CYSA_YERPE Sulfate/thiosulfate import ATP-binding protein CysA OS=Yersinia pestis GN=cysA PE=3 SV=2 43 256 1.0E-16
sp|Q02QT1|SSUB2_PSEAB Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ssuB2 PE=3 SV=1 24 246 1.0E-16
sp|Q1IGZ0|METN2_PSEE4 Methionine import ATP-binding protein MetN 2 OS=Pseudomonas entomophila (strain L48) GN=metN2 PE=3 SV=1 51 289 1.0E-16
sp|Q83MC5|METN_SHIFL Methionine import ATP-binding protein MetN OS=Shigella flexneri GN=metN PE=3 SV=1 44 288 1.0E-16
sp|Q0T810|METN_SHIF8 Methionine import ATP-binding protein MetN OS=Shigella flexneri serotype 5b (strain 8401) GN=metN PE=3 SV=1 44 288 1.0E-16
sp|Q48PU6|METN1_PSE14 Methionine import ATP-binding protein MetN 1 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=metN1 PE=3 SV=1 51 256 1.0E-16
sp|Q92VJ2|CYSA2_RHIME Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Rhizobium meliloti (strain 1021) GN=cysA2 PE=3 SV=1 44 259 1.0E-16
sp|P21410|FBPC_SERMA Fe(3+) ions import ATP-binding protein FbpC OS=Serratia marcescens GN=fbpC PE=3 SV=1 43 256 1.0E-16
sp|P14788|CYSA_SYNE7 Sulfate/thiosulfate import ATP-binding protein CysA OS=Synechococcus elongatus (strain PCC 7942) GN=cysA PE=2 SV=1 44 256 1.0E-16
sp|Q32JQ8|METN_SHIDS Methionine import ATP-binding protein MetN OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=metN PE=3 SV=1 44 288 2.0E-16
sp|Q3KK97|METN1_PSEPF Methionine import ATP-binding protein MetN 1 OS=Pseudomonas fluorescens (strain Pf0-1) GN=metN1 PE=3 SV=1 51 289 2.0E-16
sp|Q035B3|ECFA2_LACC3 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Lactobacillus casei (strain ATCC 334) GN=ecfA2 PE=1 SV=1 44 246 2.0E-16
sp|Q5WJP0|METN2_BACSK Methionine import ATP-binding protein MetN 2 OS=Bacillus clausii (strain KSM-K16) GN=metN2 PE=3 SV=1 44 287 2.0E-16
sp|Q5KVK2|METN_GEOKA Methionine import ATP-binding protein MetN OS=Geobacillus kaustophilus (strain HTA426) GN=metN PE=3 SV=1 42 288 2.0E-16
sp|Q325U1|METN_SHIBS Methionine import ATP-binding protein MetN OS=Shigella boydii serotype 4 (strain Sb227) GN=metN PE=3 SV=1 44 288 2.0E-16
sp|P56344|CYSA_CHLVU Probable sulfate/thiosulfate import ATP-binding protein CysA OS=Chlorella vulgaris GN=cysA PE=3 SV=1 44 259 2.0E-16
sp|Q0SFW6|METN2_RHOJR Methionine import ATP-binding protein MetN 2 OS=Rhodococcus jostii (strain RHA1) GN=metN2 PE=3 SV=1 37 256 2.0E-16
sp|Q92GP5|LOLD_RICCN Lipoprotein-releasing system ATP-binding protein LolD OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=lolD PE=3 SV=1 37 227 2.0E-16
sp|Q668Q3|FBPC_YERPS Fe(3+) ions import ATP-binding protein FbpC OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=fbpC PE=3 SV=1 43 251 2.0E-16
sp|Q1CJS9|FBPC_YERPN Fe(3+) ions import ATP-binding protein FbpC OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=fbpC PE=3 SV=1 43 251 2.0E-16
sp|Q8ZCM2|FBPC_YERPE Fe(3+) ions import ATP-binding protein FbpC OS=Yersinia pestis GN=fbpC PE=3 SV=1 43 251 2.0E-16
sp|Q1C607|FBPC_YERPA Fe(3+) ions import ATP-binding protein FbpC OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=fbpC PE=3 SV=1 43 251 2.0E-16
sp|Q0TLD2|METN_ECOL5 Methionine import ATP-binding protein MetN OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=metN PE=3 SV=1 44 288 2.0E-16
sp|Q3Z5F8|METN_SHISS Methionine import ATP-binding protein MetN OS=Shigella sonnei (strain Ss046) GN=metN PE=3 SV=1 44 288 2.0E-16
sp|Q1RFY9|METN_ECOUT Methionine import ATP-binding protein MetN OS=Escherichia coli (strain UTI89 / UPEC) GN=metN PE=3 SV=1 44 288 2.0E-16
sp|P63355|METN_ECOL6 Methionine import ATP-binding protein MetN OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=metN PE=3 SV=1 44 288 2.0E-16
sp|P63356|METN_ECO57 Methionine import ATP-binding protein MetN OS=Escherichia coli O157:H7 GN=metN PE=3 SV=1 44 288 2.0E-16
sp|P30750|METN_ECOLI Methionine import ATP-binding protein MetN OS=Escherichia coli (strain K12) GN=metN PE=1 SV=4 44 288 2.0E-16
sp|Q1RK34|LOLD_RICBR Lipoprotein-releasing system ATP-binding protein LolD OS=Rickettsia bellii (strain RML369-C) GN=lolD PE=3 SV=1 35 245 2.0E-16
sp|Q2EHL8|MACB_AGGAC Macrolide export ATP-binding/permease protein MacB OS=Aggregatibacter actinomycetemcomitans GN=macB PE=1 SV=2 51 224 2.0E-16
sp|Q2FNX9|ECFA1_METHJ Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=ecfA1 PE=3 SV=1 46 262 2.0E-16
sp|Q18AM3|POTA_PEPD6 Spermidine/putrescine import ATP-binding protein PotA OS=Peptoclostridium difficile (strain 630) GN=potA PE=3 SV=1 28 256 2.0E-16
sp|Q032A0|METN_LACLS Methionine import ATP-binding protein MetN OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=metN PE=3 SV=1 42 227 2.0E-16
sp|Q04FM1|ECFA2_OENOB Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=ecfA2 PE=3 SV=1 39 279 2.0E-16
sp|Q6N999|LOLD1_RHOPA Lipoprotein-releasing system ATP-binding protein LolD 1 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=lolD1 PE=3 SV=1 43 227 2.0E-16
sp|Q8TQ05|Y1747_METAC Putative ABC transporter ATP-binding protein MA_1747 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_1747 PE=3 SV=1 44 311 2.0E-16
sp|Q9KTJ5|METN_VIBCH Methionine import ATP-binding protein MetN OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=metN PE=3 SV=1 38 256 2.0E-16
sp|P42423|YXDL_BACSU ABC transporter ATP-binding protein YxdL OS=Bacillus subtilis (strain 168) GN=yxdL PE=2 SV=2 51 233 2.0E-16
sp|P27675|GLNQ_GEOSE Glutamine transport ATP-binding protein GlnQ OS=Geobacillus stearothermophilus GN=glnQ PE=2 SV=1 43 246 3.0E-16
sp|Q9PDN2|CYSA_XYLFA Sulfate/thiosulfate import ATP-binding protein CysA OS=Xylella fastidiosa (strain 9a5c) GN=cysA PE=3 SV=1 42 256 3.0E-16
sp|Q9K619|BCEA_BACHD Bacitracin export ATP-binding protein BceA OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=bceA PE=3 SV=1 41 233 3.0E-16
sp|Q7VNG4|POTA_HAEDU Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=potA PE=3 SV=1 11 280 3.0E-16
sp|Q9ZJ34|METN_HELPJ Methionine import ATP-binding protein MetN OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=metN PE=3 SV=1 36 256 3.0E-16
sp|Q8YK28|PHNC3_NOSS1 Phosphonates import ATP-binding protein PhnC 3 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=phnC3 PE=3 SV=1 54 258 3.0E-16
sp|Q5M1F6|METN_STRT1 Methionine import ATP-binding protein MetN OS=Streptococcus thermophilus (strain CNRZ 1066) GN=metN PE=3 SV=1 21 277 3.0E-16
sp|Q9HYG4|SSUB1_PSEAE Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ssuB1 PE=3 SV=1 24 246 3.0E-16
sp|Q5NFU5|METN_FRATT Methionine import ATP-binding protein MetN OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=metN PE=3 SV=2 43 256 3.0E-16
sp|Q8D653|CYSA_VIBVU Sulfate/thiosulfate import ATP-binding protein CysA OS=Vibrio vulnificus (strain CMCP6) GN=cysA PE=3 SV=1 42 256 3.0E-16
sp|Q04EY5|ECFA1_OENOB Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=ecfA1 PE=3 SV=1 44 246 3.0E-16
sp|Q14H97|METN_FRAT1 Methionine import ATP-binding protein MetN OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=metN PE=3 SV=2 43 256 3.0E-16
sp|D8KFN1|METN_LACLN Methionine import ATP-binding protein MetN OS=Lactococcus lactis subsp. cremoris (strain NZ9000) GN=metN PE=3 SV=1 42 227 3.0E-16
sp|P0CI33|METN_LACLM Methionine import ATP-binding protein MetN OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=metN PE=3 SV=1 42 227 3.0E-16
sp|Q7A169|POTA_STAAW Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus aureus (strain MW2) GN=potA PE=3 SV=1 52 256 3.0E-16
sp|Q6GAB5|POTA_STAAS Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus aureus (strain MSSA476) GN=potA PE=3 SV=1 52 256 3.0E-16
sp|Q6GHY6|POTA_STAAR Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus aureus (strain MRSA252) GN=potA PE=3 SV=1 52 256 3.0E-16
sp|Q7A679|POTA_STAAN Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus aureus (strain N315) GN=potA PE=1 SV=1 52 256 3.0E-16
sp|Q99V03|POTA_STAAM Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=potA PE=3 SV=1 52 256 3.0E-16
sp|Q5HGY5|POTA_STAAC Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus aureus (strain COL) GN=potA PE=3 SV=1 52 256 3.0E-16
sp|Q2YX74|POTA_STAAB Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=potA PE=3 SV=1 52 256 3.0E-16
sp|Q2G2A7|POTA_STAA8 Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus aureus (strain NCTC 8325) GN=potA PE=3 SV=1 52 256 3.0E-16
sp|Q2FHY1|POTA_STAA3 Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus aureus (strain USA300) GN=potA PE=3 SV=1 52 256 3.0E-16
sp|Q2K4V4|UGPC2_RHIEC sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ugpC2 PE=3 SV=1 28 259 4.0E-16
sp|Q1DDP4|METN_MYXXD Methionine import ATP-binding protein MetN OS=Myxococcus xanthus (strain DK 1622) GN=metN PE=3 SV=1 21 227 4.0E-16
sp|Q5YZY9|CYSA_NOCFA Sulfate/thiosulfate import ATP-binding protein CysA OS=Nocardia farcinica (strain IFM 10152) GN=cysA PE=3 SV=1 44 256 4.0E-16
sp|Q080S4|LOLD_SHEFN Lipoprotein-releasing system ATP-binding protein LolD OS=Shewanella frigidimarina (strain NCIMB 400) GN=lolD PE=3 SV=1 35 245 4.0E-16
sp|Q57293|FBPC_ACTPL Fe(3+) ions import ATP-binding protein FbpC OS=Actinobacillus pleuropneumoniae GN=fbpC PE=3 SV=1 42 245 4.0E-16
sp|Q88ZJ6|POTA_LACPL Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=potA PE=3 SV=1 43 256 4.0E-16
sp|Q8U4L3|Y068_PYRFU Putative ABC transporter ATP-binding protein PF0068 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF0068 PE=3 SV=1 41 261 4.0E-16
sp|Q9HT70|METN2_PSEAE Methionine import ATP-binding protein MetN 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=metN2 PE=3 SV=1 51 287 4.0E-16
sp|Q02DK6|METN2_PSEAB Methionine import ATP-binding protein MetN 2 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=metN2 PE=3 SV=1 51 287 4.0E-16
sp|Q0I2Z4|FBPC_HAES1 Fe(3+) ions import ATP-binding protein FbpC OS=Haemophilus somnus (strain 129Pt) GN=fbpC PE=3 SV=1 43 246 4.0E-16
sp|Q39GT7|NODI_BURL3 Nod factor export ATP-binding protein I OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=nodI PE=3 SV=2 41 252 4.0E-16
sp|Q7N8B9|FBPC_PHOLL Fe(3+) ions import ATP-binding protein FbpC OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=fbpC PE=3 SV=1 41 252 4.0E-16
sp|Q9I2N4|MODC_PSEAE Molybdenum import ATP-binding protein ModC OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=modC PE=3 SV=1 46 256 5.0E-16
sp|Q48CA0|SSUB3_PSE14 Aliphatic sulfonates import ATP-binding protein SsuB 3 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ssuB3 PE=3 SV=1 24 246 5.0E-16
sp|A0PY57|POTA_CLONN Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium novyi (strain NT) GN=potA PE=3 SV=1 43 277 5.0E-16
sp|Q9CP06|POTA_PASMU Spermidine/putrescine import ATP-binding protein PotA OS=Pasteurella multocida (strain Pm70) GN=potA PE=3 SV=2 41 280 5.0E-16
sp|Q83LP0|MSBA_SHIFL Lipid A export ATP-binding/permease protein MsbA OS=Shigella flexneri GN=msbA PE=3 SV=1 1 259 5.0E-16
sp|Q32E34|MSBA_SHIDS Lipid A export ATP-binding/permease protein MsbA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=msbA PE=3 SV=1 1 259 5.0E-16
sp|Q31YT6|MSBA_SHIBS Lipid A export ATP-binding/permease protein MsbA OS=Shigella boydii serotype 4 (strain Sb227) GN=msbA PE=3 SV=1 1 259 5.0E-16
sp|P60752|MSBA_ECOLI Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli (strain K12) GN=msbA PE=1 SV=1 1 259 5.0E-16
sp|P60753|MSBA_ECO57 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O157:H7 GN=msbA PE=3 SV=1 1 259 5.0E-16
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 292 623 5.0E-16
sp|Q1RDU4|MSBA_ECOUT Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli (strain UTI89 / UPEC) GN=msbA PE=3 SV=1 1 259 6.0E-16
sp|Q8FJB1|MSBA_ECOL6 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=msbA PE=3 SV=1 1 259 6.0E-16
sp|Q0TJD9|MSBA_ECOL5 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=msbA PE=3 SV=1 1 259 6.0E-16
sp|Q8XZP8|CYSA_RALSO Sulfate/thiosulfate import ATP-binding protein CysA OS=Ralstonia solanacearum (strain GMI1000) GN=cysA PE=3 SV=1 44 252 6.0E-16
sp|P97998|MDL1_CANAX ATP-dependent permease MDL1 OS=Candida albicans GN=MDL1 PE=3 SV=1 4 230 6.0E-16
sp|Q3Z3K7|MSBA_SHISS Lipid A export ATP-binding/permease protein MsbA OS=Shigella sonnei (strain Ss046) GN=msbA PE=3 SV=1 1 259 6.0E-16
sp|Q4L4R9|METN_STAHJ Methionine import ATP-binding protein MetN OS=Staphylococcus haemolyticus (strain JCSC1435) GN=metN PE=3 SV=1 44 287 6.0E-16
sp|Q9L1C3|METN_STRCO Methionine import ATP-binding protein MetN OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=metN PE=3 SV=2 21 256 6.0E-16
sp|Q38UU0|ECFA2_LACSS Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=ecfA2 PE=3 SV=1 44 245 6.0E-16
sp|Q0I3Y9|POTA_HAES1 Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus somnus (strain 129Pt) GN=potA PE=3 SV=1 41 280 6.0E-16
sp|Q2JLH7|PHNC2_SYNJB Phosphonates import ATP-binding protein PhnC 2 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=phnC2 PE=3 SV=1 18 226 7.0E-16
sp|Q68W38|LOLD_RICTY Lipoprotein-releasing system ATP-binding protein LolD OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=lolD PE=3 SV=1 38 245 7.0E-16
sp|Q8DU24|PSTB1_STRMU Phosphate import ATP-binding protein PstB 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=pstB1 PE=3 SV=1 55 277 7.0E-16
sp|Q4ZLS1|SSUB3_PSEU2 Aliphatic sulfonates import ATP-binding protein SsuB 3 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ssuB3 PE=3 SV=1 24 246 7.0E-16
sp|Q1MCN6|UGPC1_RHIL3 sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ugpC1 PE=3 SV=1 43 259 8.0E-16
sp|Q5M5Z2|METN_STRT2 Methionine import ATP-binding protein MetN OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=metN PE=3 SV=1 21 277 8.0E-16
sp|Q8P2K6|METN_STRP8 Methionine import ATP-binding protein MetN OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=metN PE=3 SV=1 26 227 8.0E-16
sp|Q1GB17|POTA_LACDA Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=potA PE=3 SV=2 51 286 8.0E-16
sp|A0LM36|MACB_SYNFM Macrolide export ATP-binding/permease protein MacB OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=macB PE=3 SV=1 51 258 8.0E-16
sp|Q98G42|UGPC_RHILO sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhizobium loti (strain MAFF303099) GN=ugpC PE=3 SV=1 27 256 8.0E-16
sp|Q38WL5|METN_LACSS Methionine import ATP-binding protein MetN OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=metN PE=3 SV=1 38 227 9.0E-16
sp|O26096|METN_HELPY Methionine import ATP-binding protein MetN OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=metN PE=3 SV=1 36 256 9.0E-16
sp|Q5UW69|PHNC2_HALMA Phosphonates import ATP-binding protein PhnC 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=phnC2 PE=3 SV=1 51 258 1.0E-15
sp|Q9ZCM4|LOLD_RICPR Lipoprotein-releasing system ATP-binding protein LolD OS=Rickettsia prowazekii (strain Madrid E) GN=lolD PE=3 SV=1 35 245 1.0E-15
sp|Q04DA7|METN2_OENOB Methionine import ATP-binding protein MetN 2 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=metN2 PE=3 SV=1 44 227 1.0E-15
sp|Q6LKD4|FBPC_PHOPR Fe(3+) ions import ATP-binding protein FbpC OS=Photobacterium profundum GN=fbpC PE=3 SV=2 41 256 1.0E-15
sp|Q0VT01|MACB_ALCBS Macrolide export ATP-binding/permease protein MacB OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=macB PE=3 SV=1 29 223 1.0E-15
sp|Q578K3|FBPC_BRUAB Fe(3+) ions import ATP-binding protein FbpC OS=Brucella abortus biovar 1 (strain 9-941) GN=fbpC PE=3 SV=1 42 258 1.0E-15
sp|Q2YKX3|FBPC_BRUA2 Fe(3+) ions import ATP-binding protein FbpC OS=Brucella abortus (strain 2308) GN=fbpC PE=3 SV=1 42 258 1.0E-15
sp|Q6WB63|PHNC_ALCFA Phosphonates import ATP-binding protein PhnC OS=Alcaligenes faecalis GN=phnC PE=3 SV=1 51 226 1.0E-15
sp|Q49W48|METN_STAS1 Methionine import ATP-binding protein MetN OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=metN PE=3 SV=1 33 287 1.0E-15
sp|P50332|NODI_RHIGA Nod factor export ATP-binding protein I OS=Rhizobium galegae GN=nodI PE=3 SV=1 20 246 1.0E-15
sp|Q8T674|ABCGK_DICDI ABC transporter G family member 20 OS=Dictyostelium discoideum GN=abcG20 PE=3 SV=1 43 295 1.0E-15
sp|Q8DIA0|CYSA_THEEB Sulfate/thiosulfate import ATP-binding protein CysA OS=Thermosynechococcus elongatus (strain BP-1) GN=cysA PE=3 SV=1 44 259 1.0E-15
sp|Q73XU8|CYSA_MYCPA Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=cysA PE=3 SV=1 44 256 1.0E-15
sp|Q5HQ70|POTA_STAEQ Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=potA PE=3 SV=1 43 288 1.0E-15
sp|Q8TYV9|Y182_METKA Putative ABC transporter ATP-binding protein MK0182 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=MK0182 PE=3 SV=1 51 272 1.0E-15
sp|Q7NQN5|POTA_CHRVO Spermidine/putrescine import ATP-binding protein PotA OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=potA PE=3 SV=1 42 277 1.0E-15
sp|O57872|Y132_PYRHO Putative ABC transporter ATP-binding protein PH0132 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0132 PE=3 SV=1 56 275 1.0E-15
sp|Q8UKE4|MACB_AGRFC Macrolide export ATP-binding/permease protein MacB OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=macB PE=3 SV=1 43 244 1.0E-15
sp|Q83LR7|MACB_SHIFL Macrolide export ATP-binding/permease protein MacB OS=Shigella flexneri GN=macB PE=3 SV=1 51 229 1.0E-15
sp|P47311|Y065_MYCGE Putative ABC transporter ATP-binding protein MG065 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG065 PE=3 SV=1 43 246 1.0E-15
sp|Q3AAA4|PSTB_CARHZ Phosphate import ATP-binding protein PstB OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=pstB PE=3 SV=1 46 230 1.0E-15
sp|Q63VX7|MSBA_BURPS Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain K96243) GN=msbA PE=3 SV=1 1 246 1.0E-15
sp|Q3JUI6|MSBA_BURP1 Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain 1710b) GN=msbA PE=3 SV=2 1 246 1.0E-15
sp|Q62IG3|MSBA_BURMA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia mallei (strain ATCC 23344) GN=msbA PE=3 SV=2 1 246 1.0E-15
sp|Q8KZQ6|SSUB_PSEPU Aliphatic sulfonates import ATP-binding protein SsuB OS=Pseudomonas putida GN=ssuB PE=1 SV=1 41 247 1.0E-15
sp|Q8XHV3|ECFA2_CLOPE Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium perfringens (strain 13 / Type A) GN=ecfA2 PE=3 SV=1 41 269 1.0E-15
sp|Q0TMS8|ECFA2_CLOP1 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=ecfA2 PE=3 SV=1 41 269 1.0E-15
sp|Q6D5H7|METN1_PECAS Methionine import ATP-binding protein MetN 1 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=metN1 PE=3 SV=1 44 229 1.0E-15
sp|Q97JB8|Y1368_CLOAB Putative ABC transporter ATP-binding protein CA_C1368 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=CA_C1368 PE=3 SV=1 51 277 1.0E-15
sp|Q323M3|MACB_SHIBS Macrolide export ATP-binding/permease protein MacB OS=Shigella boydii serotype 4 (strain Sb227) GN=macB PE=3 SV=1 51 229 1.0E-15
sp|Q50801|Y583_METTM Putative ABC transporter ATP-binding protein MTBMA_c05830 OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=MTBMA_c05830 PE=3 SV=2 47 298 1.0E-15
sp|O32151|YURJ_BACSU Uncharacterized ABC transporter ATP-binding protein YurJ OS=Bacillus subtilis (strain 168) GN=yurJ PE=3 SV=1 44 259 2.0E-15
sp|Q2W1R8|MODC_MAGSA Molybdenum import ATP-binding protein ModC OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=modC PE=3 SV=1 56 251 2.0E-15
sp|Q48V78|METN_STRPM Methionine import ATP-binding protein MetN OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=metN PE=3 SV=1 26 289 2.0E-15
sp|Q9A1E3|METN_STRP1 Methionine import ATP-binding protein MetN OS=Streptococcus pyogenes serotype M1 GN=metN PE=3 SV=1 26 289 2.0E-15
sp|A1VZQ5|PEB1C_CAMJJ Probable ABC transporter ATP-binding protein PEB1C OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=peb1C PE=3 SV=1 43 245 2.0E-15
sp|Q87DT9|CYSA_XYLFT Sulfate/thiosulfate import ATP-binding protein CysA OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=cysA PE=3 SV=1 42 245 2.0E-15
sp|Q04BG2|POTA_LACDB Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=potA PE=3 SV=1 51 286 2.0E-15
sp|Q97EK9|ECFA2_CLOAB Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=ecfA2 PE=3 SV=1 41 269 2.0E-15
sp|Q21XK2|METN_RHOFT Methionine import ATP-binding protein MetN OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=metN PE=3 SV=1 51 256 2.0E-15
sp|Q30V33|POTA_DESAG Spermidine/putrescine import ATP-binding protein PotA OS=Desulfovibrio alaskensis (strain G20) GN=potA PE=3 SV=1 44 262 2.0E-15
sp|Q32DZ9|MACB_SHIDS Macrolide export ATP-binding/permease protein MacB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=macB PE=3 SV=1 51 229 2.0E-15
sp|Q8Z0H0|CYSA_NOSS1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cysA PE=3 SV=1 44 266 2.0E-15
sp|P44531|FBPC1_HAEIN Fe(3+) ions import ATP-binding protein FbpC 1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fbpC1 PE=3 SV=1 43 246 2.0E-15
sp|Q1JNE0|METN_STRPC Methionine import ATP-binding protein MetN OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=metN PE=3 SV=1 26 289 2.0E-15
sp|Q1JDG6|METN_STRPB Methionine import ATP-binding protein MetN OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=metN PE=3 SV=1 26 289 2.0E-15
sp|Q0P9X7|PEB1C_CAMJE Probable ABC transporter ATP-binding protein PEB1C OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=peb1C PE=3 SV=1 43 245 2.0E-15
sp|Q664X5|MALK_YERPS Maltose/maltodextrin import ATP-binding protein MalK OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=malK PE=3 SV=1 51 260 2.0E-15
sp|Q1CNR8|MALK_YERPN Maltose/maltodextrin import ATP-binding protein MalK OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=malK PE=3 SV=1 51 260 2.0E-15
sp|Q8ZAS8|MALK_YERPE Maltose/maltodextrin import ATP-binding protein MalK OS=Yersinia pestis GN=malK PE=3 SV=1 51 260 2.0E-15
sp|Q1CC21|MALK_YERPA Maltose/maltodextrin import ATP-binding protein MalK OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=malK PE=3 SV=1 51 260 2.0E-15
sp|Q9CIN4|METN_LACLA Methionine import ATP-binding protein MetN OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=metN PE=3 SV=1 51 227 2.0E-15
sp|Q20ZS6|LOLD2_RHOPB Lipoprotein-releasing system ATP-binding protein LolD 2 OS=Rhodopseudomonas palustris (strain BisB18) GN=lolD2 PE=3 SV=1 43 227 2.0E-15
sp|Q1WVI7|POTA_LACS1 Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus salivarius (strain UCC118) GN=potA PE=3 SV=1 30 262 2.0E-15
sp|Q1LQF6|METN_CUPMC Methionine import ATP-binding protein MetN OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=metN PE=3 SV=1 51 256 3.0E-15
sp|P10346|GLNQ_ECOLI Glutamine transport ATP-binding protein GlnQ OS=Escherichia coli (strain K12) GN=glnQ PE=1 SV=1 43 224 3.0E-15
sp|Q13VD7|METN1_BURXL Methionine import ATP-binding protein MetN 1 OS=Burkholderia xenovorans (strain LB400) GN=metN1 PE=3 SV=1 46 256 3.0E-15
sp|Q1QVQ7|METN_CHRSD Methionine import ATP-binding protein MetN OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=metN PE=3 SV=1 46 255 3.0E-15
sp|Q7MN25|METN_VIBVY Methionine import ATP-binding protein MetN OS=Vibrio vulnificus (strain YJ016) GN=metN PE=3 SV=1 37 227 3.0E-15
sp|Q0SRL2|POTA_CLOPS Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium perfringens (strain SM101 / Type A) GN=potA PE=3 SV=2 42 256 3.0E-15
sp|Q1CR30|METN_HELPH Methionine import ATP-binding protein MetN OS=Helicobacter pylori (strain HPAG1) GN=metN PE=3 SV=1 36 256 3.0E-15
sp|Q8DFC3|METN_VIBVU Methionine import ATP-binding protein MetN OS=Vibrio vulnificus (strain CMCP6) GN=metN PE=3 SV=1 37 227 3.0E-15
sp|Q92NU9|MACB_RHIME Macrolide export ATP-binding/permease protein MacB OS=Rhizobium meliloti (strain 1021) GN=macB PE=3 SV=1 51 245 3.0E-15
sp|Q8FVV5|FBPC_BRUSU Fe(3+) ions import ATP-binding protein FbpC OS=Brucella suis biovar 1 (strain 1330) GN=fbpC PE=3 SV=1 42 258 3.0E-15
sp|Q65T42|CYSA_MANSM Sulfate/thiosulfate import ATP-binding protein CysA OS=Mannheimia succiniciproducens (strain MBEL55E) GN=cysA PE=3 SV=1 46 246 3.0E-15
sp|Q9CM80|FBPC_PASMU Fe(3+) ions import ATP-binding protein FbpC OS=Pasteurella multocida (strain Pm70) GN=fbpC PE=3 SV=1 43 246 3.0E-15
sp|Q13LC4|PHNC_BURXL Phosphonates import ATP-binding protein PhnC OS=Burkholderia xenovorans (strain LB400) GN=phnC PE=3 SV=1 41 251 3.0E-15
sp|P0CZ31|METN_STRPQ Methionine import ATP-binding protein MetN OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=metN PE=3 SV=1 26 289 3.0E-15
sp|P0CZ30|METN_STRP3 Methionine import ATP-binding protein MetN OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=metN PE=3 SV=1 26 289 3.0E-15
sp|Q9HPH7|Y1631_HALSA Putative ABC transporter ATP-binding protein VNG_1631G OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=VNG_1631G PE=3 SV=1 42 251 3.0E-15
sp|Q1WVG9|METN_LACS1 Methionine import ATP-binding protein MetN OS=Lactobacillus salivarius (strain UCC118) GN=metN PE=3 SV=1 35 227 3.0E-15
sp|Q12NL5|LOLD_SHEDO Lipoprotein-releasing system ATP-binding protein LolD OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=lolD PE=3 SV=1 43 248 3.0E-15
sp|Q7N8M2|METN_PHOLL Methionine import ATP-binding protein MetN OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=metN PE=3 SV=1 51 227 3.0E-15
sp|Q3JSQ0|NODI_BURP1 Nod factor export ATP-binding protein I OS=Burkholderia pseudomallei (strain 1710b) GN=nodI PE=3 SV=2 41 252 3.0E-15
sp|Q62K72|NODI_BURMA Nod factor export ATP-binding protein I OS=Burkholderia mallei (strain ATCC 23344) GN=nodI PE=3 SV=2 41 252 3.0E-15
sp|Q65UE1|POTA_MANSM Spermidine/putrescine import ATP-binding protein PotA OS=Mannheimia succiniciproducens (strain MBEL55E) GN=potA PE=3 SV=1 42 280 3.0E-15
sp|Q82HA2|Y3608_STRAW Putative ABC transporter ATP-binding protein SAV_3608 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=SAV_3608 PE=3 SV=1 46 256 3.0E-15
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 368 565 7.0E-14
sp|Q972J5|Y1136_SULTO Putative ABC transporter ATP-binding protein STK_11360 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_11360 PE=3 SV=1 41 199 2.0E-10
sp|Q8TQ05|Y1747_METAC Putative ABC transporter ATP-binding protein MA_1747 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_1747 PE=3 SV=1 51 266 3.0E-09
sp|P12428|BROWN_DROME Protein brown OS=Drosophila melanogaster GN=bw PE=2 SV=1 217 522 3.0E-08
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 328 621 3.0E-07
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 344 621 6.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005524 ATP binding Yes
GO:0016887 ATPase activity Yes
GO:0017076 purine nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0016787 hydrolase activity No
GO:0032555 purine ribonucleotide binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0030554 adenyl nucleotide binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0036094 small molecule binding No
GO:0008144 drug binding No
GO:0003674 molecular_function No
GO:0016462 pyrophosphatase activity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

Domain # Start End Length
1 364 386 22
2 396 418 22
3 439 461 22
4 474 496 22
5 503 525 22
6 597 619 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|974
MDPEQRPAAGEHLQNTTVGSVAWRGVTVTVRDRDRDAKQIKTIVDNVDGIVEAGECCALMGPSGSGKTTLLNALA
RRPTGGASVSQAEILVNGSNLPLSEFRQVTSFVEERDALIGSLTVFETLAFASKLSTTRDKHERLLRINALLDAF
GLSDRANVLIGTPARKGISDGQKRRVSIASQLITEPKILFLDEPTSGLDSVASFEVVRYLRQLAKRHNLIVICSI
HQPSSSTFNLFDKLLLLSEGKTHYFGAVGDVAEYYEEMGVSIPRRVNTAEFLLELVNADFAEDKALARRRLAELQ
EAWSGSRHAKETHAAALGAKKLDGGASPVGSESESAAAKKPGAWARTVTLLHRGVIKSYRDVLAYGIRLAMYVGL
ALMMGTVWLRLRPEQESIQPLINGIFFGSAFMSFMAVAYVPAFLEDYQTFVKERRNGLCGPLELVLSNLLVGAPC
LFAIAAVFSAITYWLSAFRPGADAFLTWLMWLFLDLLAAESLVVLVASLLPNFVVALAVVAFANGLWMSVGGFMV
PPALLNAFYRYAFHPWDYQRYVFEGMMVNEFARRSYDCGPACRCMYDSALADRCSIDGRAVLDRYGYQPGSTGRH
VGILVAIVAGYRLAAWLVLRWKSS*
Coding >Hirsu2|974
ATGGACCCAGAGCAGCGCCCCGCTGCCGGAGAGCACCTGCAAAACACCACGGTTGGCAGCGTCGCATGGCGAGGT
GTCACCGTCACCGTACGCGATCGCGATCGCGACGCTAAGCAGATCAAGACCATCGTCGACAACGTCGACGGCATC
GTGGAAGCCGGCGAATGCTGCGCCCTGATGGGCCCCTCGGGCAGTGGCAAGACGACACTGCTGAATGCCTTGGCC
AGGCGACCGACGGGTGGTGCTTCGGTTTCCCAGGCTGAGATCCTCGTGAACGGCAGCAACCTGCCGCTGTCCGAG
TTCCGTCAAGTCACGTCCTTTGTCGAGGAGCGCGATGCGCTCATCGGGTCCCTGACGGTGTTTGAGACGCTGGCC
TTCGCCTCCAAACTGTCTACCACCAGGGACAAGCACGAGCGTCTGCTGCGCATCAACGCGCTGCTGGACGCATTT
GGCCTCTCGGACCGGGCCAACGTGCTCATCGGCACGCCCGCCCGCAAGGGCATCTCGGACGGGCAGAAGCGGCGC
GTGAGTATCGCGAGCCAGCTGATTACCGAGCCCAAGATCCTCTTCCTGGACGAGCCGACGAGCGGGCTCGACTCG
GTCGCCAGCTTCGAGGTCGTCCGGTATCTGCGCCAGCTGGCCAAGCGGCACAACCTCATCGTCATCTGCTCCATC
CACCAGCCGTCCTCGTCCACCTTCAACCTATTCGACAAGCTGCTGCTGCTGTCGGAGGGCAAGACGCACTACTTC
GGCGCCGTGGGGGACGTGGCCGAGTACTACGAGGAGATGGGCGTCAGCATCCCCCGGCGGGTCAACACGGCCGAG
TTCCTGCTGGAGCTCGTCAACGCGGACTTTGCCGAGGACAAGGCTCTCGCCAGAAGACGGCTAGCCGAGCTGCAG
GAGGCCTGGAGCGGCTCGCGCCACGCCAAGGAAACCCACGCCGCGGCACTGGGCGCCAAAAAGCTGGACGGCGGC
GCATCGCCGGTGGGGTCGGAGTCGGAGTCGGCGGCGGCGAAGAAGCCGGGCGCGTGGGCGCGGACCGTCACGCTG
CTGCACCGCGGCGTCATCAAGAGCTACCGCGACGTGCTGGCGTACGGGATCCGGCTGGCCATGTACGTGGGGCTG
GCGCTGATGATGGGCACCGTCTGGCTGCGGCTGCGGCCGGAGCAGGAGTCGATCCAGCCGCTGATCAACGGCATC
TTCTTCGGCTCGGCCTTCATGTCCTTCATGGCGGTCGCGTACGTGCCGGCCTTCCTGGAGGACTACCAGACCTTC
GTCAAGGAGCGGCGCAACGGCCTGTGCGGGCCGCTGGAGCTGGTGCTGTCGAACCTGCTGGTGGGCGCGCCGTGC
CTCTTCGCCATCGCCGCCGTCTTCTCCGCCATCACGTACTGGCTGTCGGCCTTCCGGCCCGGAGCCGACGCCTTC
CTCACCTGGCTCATGTGGCTCTTCCTCGACCTGCTGGCGGCCGAGTCGTTGGTGGTGCTGGTGGCGTCGCTGCTG
CCCAACTTCGTCGTCGCCCTGGCCGTCGTCGCCTTCGCCAACGGCCTGTGGATGTCCGTCGGCGGCTTCATGGTG
CCGCCCGCCCTGCTCAACGCCTTCTACCGCTACGCCTTCCACCCCTGGGACTACCAGCGCTACGTCTTCGAGGGC
ATGATGGTCAACGAGTTCGCCCGCCGCTCGTACGACTGCGGGCCCGCCTGCCGCTGCATGTACGACTCCGCCCTG
GCCGACCGCTGCAGCATCGACGGCCGCGCCGTCCTCGACCGCTACGGCTACCAGCCCGGCTCCACGGGCCGGCAC
GTCGGCATCCTGGTCGCCATCGTCGCGGGCTACCGGCTCGCGGCCTGGCTGGTGCTTCGGTGGAAGAGCTCTTGA
Transcript >Hirsu2|974
ATGGACCCAGAGCAGCGCCCCGCTGCCGGAGAGCACCTGCAAAACACCACGGTTGGCAGCGTCGCATGGCGAGGT
GTCACCGTCACCGTACGCGATCGCGATCGCGACGCTAAGCAGATCAAGACCATCGTCGACAACGTCGACGGCATC
GTGGAAGCCGGCGAATGCTGCGCCCTGATGGGCCCCTCGGGCAGTGGCAAGACGACACTGCTGAATGCCTTGGCC
AGGCGACCGACGGGTGGTGCTTCGGTTTCCCAGGCTGAGATCCTCGTGAACGGCAGCAACCTGCCGCTGTCCGAG
TTCCGTCAAGTCACGTCCTTTGTCGAGGAGCGCGATGCGCTCATCGGGTCCCTGACGGTGTTTGAGACGCTGGCC
TTCGCCTCCAAACTGTCTACCACCAGGGACAAGCACGAGCGTCTGCTGCGCATCAACGCGCTGCTGGACGCATTT
GGCCTCTCGGACCGGGCCAACGTGCTCATCGGCACGCCCGCCCGCAAGGGCATCTCGGACGGGCAGAAGCGGCGC
GTGAGTATCGCGAGCCAGCTGATTACCGAGCCCAAGATCCTCTTCCTGGACGAGCCGACGAGCGGGCTCGACTCG
GTCGCCAGCTTCGAGGTCGTCCGGTATCTGCGCCAGCTGGCCAAGCGGCACAACCTCATCGTCATCTGCTCCATC
CACCAGCCGTCCTCGTCCACCTTCAACCTATTCGACAAGCTGCTGCTGCTGTCGGAGGGCAAGACGCACTACTTC
GGCGCCGTGGGGGACGTGGCCGAGTACTACGAGGAGATGGGCGTCAGCATCCCCCGGCGGGTCAACACGGCCGAG
TTCCTGCTGGAGCTCGTCAACGCGGACTTTGCCGAGGACAAGGCTCTCGCCAGAAGACGGCTAGCCGAGCTGCAG
GAGGCCTGGAGCGGCTCGCGCCACGCCAAGGAAACCCACGCCGCGGCACTGGGCGCCAAAAAGCTGGACGGCGGC
GCATCGCCGGTGGGGTCGGAGTCGGAGTCGGCGGCGGCGAAGAAGCCGGGCGCGTGGGCGCGGACCGTCACGCTG
CTGCACCGCGGCGTCATCAAGAGCTACCGCGACGTGCTGGCGTACGGGATCCGGCTGGCCATGTACGTGGGGCTG
GCGCTGATGATGGGCACCGTCTGGCTGCGGCTGCGGCCGGAGCAGGAGTCGATCCAGCCGCTGATCAACGGCATC
TTCTTCGGCTCGGCCTTCATGTCCTTCATGGCGGTCGCGTACGTGCCGGCCTTCCTGGAGGACTACCAGACCTTC
GTCAAGGAGCGGCGCAACGGCCTGTGCGGGCCGCTGGAGCTGGTGCTGTCGAACCTGCTGGTGGGCGCGCCGTGC
CTCTTCGCCATCGCCGCCGTCTTCTCCGCCATCACGTACTGGCTGTCGGCCTTCCGGCCCGGAGCCGACGCCTTC
CTCACCTGGCTCATGTGGCTCTTCCTCGACCTGCTGGCGGCCGAGTCGTTGGTGGTGCTGGTGGCGTCGCTGCTG
CCCAACTTCGTCGTCGCCCTGGCCGTCGTCGCCTTCGCCAACGGCCTGTGGATGTCCGTCGGCGGCTTCATGGTG
CCGCCCGCCCTGCTCAACGCCTTCTACCGCTACGCCTTCCACCCCTGGGACTACCAGCGCTACGTCTTCGAGGGC
ATGATGGTCAACGAGTTCGCCCGCCGCTCGTACGACTGCGGGCCCGCCTGCCGCTGCATGTACGACTCCGCCCTG
GCCGACCGCTGCAGCATCGACGGCCGCGCCGTCCTCGACCGCTACGGCTACCAGCCCGGCTCCACGGGCCGGCAC
GTCGGCATCCTGGTCGCCATCGTCGCGGGCTACCGGCTCGCGGCCTGGCTGGTGCTTCGGTGGAAGAGCTCTTGA
Gene >Hirsu2|974
ATGGACCCAGAGCAGCGCCCCGCTGCCGGAGAGCACCTGCAAAACACCACGGTTGGCAGCGTCGCATGGCGAGGT
GTCACCGTCACCGTACGCGATCGCGATCGCGACGCTAAGCAGATCAAGACCATCGTCGACAACGTCGACGGCATC
GTGGAAGCCGGTTTGTCCCGCCTGCGCAGGCGCCGATCCGAGCAAGGAAGGGAGGCAAACTGACAGGAGGTGCCA
AGGCGAATGCTGCGCCCTGATGGGCCCCTCGGGCAGTGGCAAGACGACACTGCTGAATGCCTTGGCCAGGCGACC
GACGGGTGGTGCTTCGGTTTCCCAGGCTGAGATCCTCGTGAACGGCAGCAACCTGCCGCTGTCCGAGTTCCGTCA
AGTCACGTCCTTTGTCGAGGAGCGCGATGCGCTCATCGGGTCCCTGACGGTGTTTGAGACGCTGGCCTTCGCCTC
CAAACTGTCTACCACCAGGCAAGTACATGGGAGTTGCGGATGCTGCCCCTTAAGACATTGCTTGGTTCGGGCCCT
GAGTCAGCAGCGAACCGCTGACGCCGGCCGCTCGGTCACAGGGACAAGCACGAGCGTCTGCTGCGCATCAACGCG
CTGCTGGACGCATTTGGCCTCTCGGACCGGGCCAACGTGCTCATCGGCACGCCCGCCCGCAAGGGCATCTCGGAC
GGGCAGAAGCGGCGCGTGAGTATCGCGAGCCAGCTGATTACCGAGCCCAAGATCCTCTTCCTGGACGAGCCGACG
AGCGGGCTCGACTCGGTCGCCAGCTTCGAGGTCGTCCGGTATCTGCGCCAGCTGGCCAAGCGGCACAACCTCATC
GTCATCTGCTCCATCCACCAGCCGTCCTCGTCCACCTTCAACCTATTCGACAAGCTGCTGCTGCTGTCGGAGGGC
AAGACGCACTACTTCGGCGCCGTGGGGGACGTGGCCGAGTACTACGAGGAGATGGGCGTCAGCATCCCCCGGCGG
GTCAACACGGCCGAGTTCCTGCTGGAGCTCGTCAACGCGGACTTTGCCGAGGACAAGGCTCTCGCCAGAAGACGG
CTAGCCGAGCTGCAGGAGGCCTGGAGCGGCTCGCGCCACGCCAAGGAAACCCACGCCGCGGCACTGGGCGCCAAA
AAGCTGGACGGCGGCGCATCGCCGGTGGGGTCGGAGTCGGAGTCGGCGGCGGCGAAGAAGCCGGGCGCGTGGGCG
CGGACCGTCACGCTGCTGCACCGCGGCGTCATCAAGAGCTACCGCGACGTGCTGGCGTACGGGATCCGGCTGGCC
ATGTACGTGGGGCTGGCGCTGATGATGGGCACCGTCTGGCTGCGGCTGCGGCCGGAGCAGGAGTCGATCCAGCCG
CTGATCAACGGCATCTTCTTCGGCTCGGCCTTCATGTCCTTCATGGCGGTCGCGTACGTGCCGGCCTTCCTGGAG
GACTACCAGACCTTCGTCAAGGAGCGGCGCAACGGCCTGTGCGGGCCGCTGGAGCTGGTGCTGTCGAACCTGCTG
GTGGGCGCGCCGTGCCTCTTCGCCATCGCCGCCGTCTTCTCCGCCATCACGTACTGGCTGTCGGCCTTCCGGCCC
GGAGCCGACGCCTTCCTCACCTGGCTCATGTGGCTCTTCCTCGACCTGCTGGCGGCCGAGTCGTTGGTGGTGCTG
GTGGCGTCGCTGCTGCCCAACTTCGTCGTCGCCCTGGCCGTCGTCGCCTTCGCCAACGGCCTGTGGATGTCCGTC
GGCGGCTTCATGGTGCCGCCCGCCCTGCTCAACGCCTTCTACCGCTACGCCTTCCACCCCTGGGACTACCAGCGC
TACGTCTTCGAGGGCATGATGGTCAACGAGTTCGCCCGCCGCTCGTACGACTGCGGGCCCGCCTGCCGCTGCATG
TACGACTCCGCCCTGGCCGACCGCTGCAGCATCGACGGCCGCGCCGTCCTCGACCGCTACGGCTACCAGCCCGGC
TCCACGGGCCGGCACGTCGGCATCCTGGTCGCCATCGTCGCGGGCTACCGGCTCGCGGCCTGGCTGGTGCTTCGG
TGGAAGAGCTCTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail