Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9729
Gene name
LocationContig_73:8815..10162
Strand+
Gene length (bp)1347
Transcript length (bp)1137
Coding sequence length (bp)1137
Protein length (aa) 379

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain 5.7E-18 10 82
PF04116 FA_hydroxylase Fatty acid hydroxylase superfamily 3.1E-12 226 369

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03529|SCS7_YEAST Ceramide very long chain fatty acid hydroxylase SCS7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCS7 PE=1 SV=1 3 373 9.0E-134
sp|O13846|SCS7_SCHPO Ceramide very long chain fatty acid hydroxylase-like protein C19G12.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC19G12.08 PE=3 SV=1 16 370 2.0E-102
sp|Q2LAM0|FA2H_RAT Fatty acid 2-hydroxylase OS=Rattus norvegicus GN=Fa2h PE=1 SV=2 8 369 5.0E-50
sp|Q4R4P4|FA2H_MACFA Fatty acid 2-hydroxylase OS=Macaca fascicularis GN=FA2H PE=2 SV=1 13 378 6.0E-50
sp|Q7L5A8|FA2H_HUMAN Fatty acid 2-hydroxylase OS=Homo sapiens GN=FA2H PE=1 SV=1 13 378 4.0E-49
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03529|SCS7_YEAST Ceramide very long chain fatty acid hydroxylase SCS7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCS7 PE=1 SV=1 3 373 9.0E-134
sp|O13846|SCS7_SCHPO Ceramide very long chain fatty acid hydroxylase-like protein C19G12.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC19G12.08 PE=3 SV=1 16 370 2.0E-102
sp|Q2LAM0|FA2H_RAT Fatty acid 2-hydroxylase OS=Rattus norvegicus GN=Fa2h PE=1 SV=2 8 369 5.0E-50
sp|Q4R4P4|FA2H_MACFA Fatty acid 2-hydroxylase OS=Macaca fascicularis GN=FA2H PE=2 SV=1 13 378 6.0E-50
sp|Q7L5A8|FA2H_HUMAN Fatty acid 2-hydroxylase OS=Homo sapiens GN=FA2H PE=1 SV=1 13 378 4.0E-49
sp|Q5MPP0|FA2H_MOUSE Fatty acid 2-hydroxylase OS=Mus musculus GN=Fa2h PE=1 SV=1 8 369 1.0E-47
sp|Q9SUC5|FAH2_ARATH Fatty acid 2-hydroxylase 2 OS=Arabidopsis thaliana GN=FAH2 PE=1 SV=1 143 369 3.0E-46
sp|O48916|FAH1_ARATH Fatty acid 2-hydroxylase 1 OS=Arabidopsis thaliana GN=FAH1 PE=1 SV=1 143 378 1.0E-45
sp|O48845|CYB5B_ARATH Cytochrome b5 isoform B OS=Arabidopsis thaliana GN=CYTB5-B PE=1 SV=1 9 86 3.0E-13
sp|P49099|CYB5S_TOBAC Cytochrome b5, seed isoform OS=Nicotiana tabacum PE=2 SV=1 9 82 8.0E-13
sp|Q9ZWT2|CYB5D_ARATH Cytochrome B5 isoform D OS=Arabidopsis thaliana GN=CYTB5-D PE=1 SV=1 9 98 2.0E-12
sp|O04354|CYB5_BOROF Cytochrome b5 OS=Borago officinalis PE=2 SV=1 9 84 2.0E-12
sp|P49098|CYB5_TOBAC Cytochrome b5 OS=Nicotiana tabacum PE=2 SV=1 9 84 5.0E-12
sp|O94391|CYB51_SCHPO Probable cytochrome b5 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC29A10.16c PE=3 SV=1 9 86 1.0E-11
sp|P49100|CYB5_ORYSJ Cytochrome b5 OS=Oryza sativa subsp. japonica GN=Os05g0108800 PE=2 SV=2 1 84 9.0E-11
sp|P49097|CYB5_CUSRE Cytochrome b5 OS=Cuscuta reflexa PE=2 SV=1 9 84 3.0E-10
sp|Q9V4N3|CYB5_DROME Cytochrome b5 OS=Drosophila melanogaster GN=Cyt-b5 PE=2 SV=1 1 82 8.0E-10
sp|Q9USM6|CYB52_SCHPO Probable cytochrome b5 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oca8 PE=3 SV=1 8 117 1.0E-09
sp|O22704|CYP5F_ARATH Cytochrome B5-like protein OS=Arabidopsis thaliana GN=CB5LP PE=2 SV=1 8 82 1.0E-09
sp|Q9FDW8|CYB5A_ARATH Cytochrome b5 isoform A OS=Arabidopsis thaliana GN=CB5-A PE=1 SV=1 6 82 2.0E-09
sp|Q42342|CYB5E_ARATH Cytochrome b5 isoform E OS=Arabidopsis thaliana GN=CYTB5-E PE=1 SV=2 13 110 6.0E-09
sp|P49096|CYB5_MUSDO Cytochrome b5 OS=Musca domestica GN=Cyt-b5 PE=1 SV=1 1 82 1.0E-08
sp|Q9P5L0|CYB5_NEUCR Probable cytochrome b5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B23L21.190 PE=3 SV=2 9 82 2.0E-08
sp|Q9Y706|CYB5_MORAP Cytochrome b5 OS=Mortierella alpina PE=1 SV=1 6 82 3.0E-08
sp|P40934|CYB5_BRAOB Cytochrome b5 OS=Brassica oleracea var. botrytis GN=CYB5 PE=1 SV=1 13 110 3.0E-08
sp|Q9HFV1|CYB5_RHIST Cytochrome b5 OS=Rhizopus stolonifer PE=2 SV=1 5 82 4.0E-08
sp|Q8X0J4|CYB5L_NEUCR Putative cytochrome b5 B11H24.095 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B11H24.095 PE=3 SV=1 8 55 1.0E-07
sp|P32953|CYBL_RHOGR (S)-mandelate dehydrogenase, mitochondrial OS=Rhodotorula graminis PE=1 SV=2 8 84 1.0E-07
sp|Q9Y1W0|FAD5A_DICDI Delta(5) fatty acid desaturase A OS=Dictyostelium discoideum GN=fadA PE=1 SV=1 9 84 1.0E-07
sp|Q874I5|CYB5_CANTR Cytochrome b5 OS=Candida tropicalis GN=Cytb5 PE=3 SV=1 9 92 2.0E-07
sp|P39866|NIA2_PHAVU Nitrate reductase [NADH] 2 OS=Phaseolus vulgaris GN=NIA2 PE=3 SV=1 9 142 2.0E-07
sp|P82291|CYB5_ECTSH Soluble cytochrome b558 OS=Ectothiorhodospira shaposhnikovii PE=1 SV=2 5 87 2.0E-07
sp|P11035|NIA2_ARATH Nitrate reductase [NADH] 2 OS=Arabidopsis thaliana GN=NIA2 PE=1 SV=1 5 142 2.0E-07
sp|Q5RDJ5|CYB5B_PONAB Cytochrome b5 type B OS=Pongo abelii GN=CYB5B PE=2 SV=2 9 94 4.0E-07
sp|Q9CQX2|CYB5B_MOUSE Cytochrome b5 type B OS=Mus musculus GN=Cyb5b PE=1 SV=1 13 86 5.0E-07
sp|P23312|NIA_SPIOL Nitrate reductase [NADH] OS=Spinacia oleracea GN=NIA PE=2 SV=1 5 142 5.0E-07
sp|P43101|NIA_CICIN Nitrate reductase [NADH] OS=Cichorium intybus GN=NIA PE=2 SV=1 8 82 6.0E-07
sp|P39867|NIA1_BRANA Nitrate reductase [NADH], clone PBNBR1405 OS=Brassica napus GN=NIA1 PE=2 SV=1 9 142 6.0E-07
sp|P00171|CYB5_BOVIN Cytochrome b5 OS=Bos taurus GN=CYB5A PE=1 SV=3 3 86 6.0E-07
sp|P39870|NIA2_SOYBN Inducible nitrate reductase [NADH] 2 OS=Glycine max GN=INR2 PE=2 SV=1 5 142 6.0E-07
sp|Q01170|NIA_CHLVU Nitrate reductase [NADH] (Fragment) OS=Chlorella vulgaris PE=2 SV=1 8 112 7.0E-07
sp|P16081|NIA1_ORYSJ Nitrate reductase [NADH] 1 OS=Oryza sativa subsp. japonica GN=NIA1 PE=2 SV=3 9 142 8.0E-07
sp|P39868|NIA2_BRANA Nitrate reductase [NADH], clone PBNBR1412 OS=Brassica napus GN=NIA2 PE=2 SV=1 9 142 9.0E-07
sp|P04166|CYB5B_RAT Cytochrome b5 type B OS=Rattus norvegicus GN=Cyb5b PE=1 SV=2 13 86 1.0E-06
sp|P00172|CYB5_PIG Cytochrome b5 OS=Sus scrofa GN=CYB5A PE=1 SV=3 4 86 2.0E-06
sp|O43169|CYB5B_HUMAN Cytochrome b5 type B OS=Homo sapiens GN=CYB5B PE=1 SV=2 13 86 2.0E-06
sp|P36859|NIA_PETHY Nitrate reductase [NADH] OS=Petunia hybrida GN=NIA PE=2 SV=1 9 142 2.0E-06
sp|P39865|NIA1_PHAVU Nitrate reductase [NADH] 1 OS=Phaseolus vulgaris GN=NIA1 PE=3 SV=1 8 142 2.0E-06
sp|Q10352|YDAA_SCHPO Uncharacterized protein C1F12.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F12.10c PE=3 SV=1 10 84 2.0E-06
sp|O74212|D5FAD_MORAP Acyl-lipid (8-3)-desaturase OS=Mortierella alpina GN=DES1 PE=1 SV=1 8 61 2.0E-06
sp|P54233|NIA1_SOYBN Inducible nitrate reductase [NADH] 1 OS=Glycine max GN=INR1 PE=2 SV=1 5 82 2.0E-06
sp|P17569|NIA_CUCMA Nitrate reductase [NADH] OS=Cucurbita maxima PE=2 SV=1 8 82 2.0E-06
sp|P11832|NIA1_ARATH Nitrate reductase [NADH] 1 OS=Arabidopsis thaliana GN=NIA1 PE=1 SV=3 9 142 2.0E-06
sp|O96099|FAD5B_DICDI Acyl-lipid (8-3)-desaturase B OS=Dictyostelium discoideum GN=fadB PE=1 SV=1 3 84 3.0E-06
sp|P27783|NIA_BETPN Nitrate reductase [NAD(P)H] OS=Betula pendula GN=NIA1 PE=2 SV=1 9 82 3.0E-06
sp|P36841|NIA_VOLCA Nitrate reductase [NADH] OS=Volvox carteri GN=NITA PE=2 SV=1 9 118 4.0E-06
sp|P00170|CYB5_HORSE Cytochrome b5 OS=Equus caballus GN=CYB5A PE=1 SV=3 4 86 4.0E-06
sp|P00173|CYB5_RAT Cytochrome b5 OS=Rattus norvegicus GN=Cyb5a PE=1 SV=2 9 86 4.0E-06
sp|P56395|CYB5_MOUSE Cytochrome b5 OS=Mus musculus GN=Cyb5a PE=1 SV=2 9 86 4.0E-06
sp|Q9VWP4|SUOX_DROME Probable sulfite oxidase, mitochondrial OS=Drosophila melanogaster GN=CG7280 PE=2 SV=1 4 49 6.0E-06
sp|P40312|CYB5_YEAST Cytochrome b5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYB5 PE=1 SV=2 9 84 6.0E-06
sp|P49102|NIA3_MAIZE Nitrate reductase [NADH] 3 OS=Zea mays PE=3 SV=1 3 82 6.0E-06
sp|P00167|CYB5_HUMAN Cytochrome b5 OS=Homo sapiens GN=CYB5A PE=1 SV=2 9 86 8.0E-06
sp|P00169|CYB5_RABIT Cytochrome b5 OS=Oryctolagus cuniculus GN=CYB5A PE=1 SV=4 9 86 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0008610 lipid biosynthetic process Yes
GO:0005506 iron ion binding Yes
GO:0055114 oxidation-reduction process Yes
GO:0046872 metal ion binding No
GO:0008152 metabolic process No
GO:0043169 cation binding No
GO:0008150 biological_process No
GO:0009058 biosynthetic process No
GO:0043167 ion binding No
GO:1901576 organic substance biosynthetic process No
GO:0003674 molecular_function No
GO:0071704 organic substance metabolic process No
GO:0006629 lipid metabolic process No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0046914 transition metal ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 194 216 22
2 223 245 22
3 278 300 22
4 307 329 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9729
MPSRTLPTFTRAEVEAHDSAASCYVTIGTKVYDVTDFVQDHPGGGDLLLEYAGRDVEDILKDPTSHPHSEAAYEV
LDDSFVGFVPPVKAVAANGHSAQLNGNANGTTGPDSATYVHPRTGMSCEEDLSKETDYSNDYRRHKFLDLGKPLF
FQIWNGGFSKDFYLDQVHRPRHYKGGQSAPLFGNFLEPLTKTPWWMVPTIWIPCVAYGSYLAAQGFNHVAVGASY
WLFGLFLWTLVEYCLHRFLFHLDDYLPDNRVGVTMHFMLHGIHHYLPMDKYRLVMPPVLFVVLATPFWHLTHVIF
SWSWHAATAVFCGGIFGYICYDLTHYFLHHENLPLWYKQLKKYHLQHHFLDYELGFGVTSKFWDKIFGTELQPPT
KTQ*
Coding >Hirsu2|9729
ATGCCTTCGCGGACGCTGCCGACCTTCACGCGCGCCGAGGTCGAGGCGCACGACTCGGCCGCCTCGTGCTATGTG
ACCATCGGCACCAAGGTGTACGACGTCACCGACTTCGTCCAAGACCACCCGGGCGGCGGCGACCTGCTGCTCGAA
TACGCCGGCCGAGACGTCGAGGATATCCTCAAGGACCCGACCTCGCACCCGCACTCCGAGGCCGCCTACGAGGTC
CTCGACGACTCCTTCGTCGGCTTCGTGCCGCCCGTGAAGGCTGTCGCCGCCAACGGGCATTCCGCGCAGCTGAAT
GGCAACGCCAACGGGACCACCGGTCCCGACTCCGCTACCTACGTGCATCCTCGCACCGGCATGTCGTGCGAAGAG
GACTTATCCAAGGAGACCGACTACAGCAATGATTACAGGAGGCACAAGTTTCTCGACCTCGGCAAGCCCCTCTTC
TTTCAAATCTGGAACGGCGGCTTCAGCAAGGATTTCTACCTGGATCAGGTCCATCGTCCGCGCCACTACAAGGGA
GGCCAGTCGGCGCCCCTGTTCGGCAACTTCCTGGAGCCCCTCACCAAGACACCTTGGTGGATGGTGCCGACCATT
TGGATACCCTGTGTCGCGTACGGCTCCTACCTCGCCGCTCAAGGCTTCAACCATGTCGCTGTCGGGGCCTCGTAC
TGGCTGTTTGGCCTGTTTCTCTGGACCCTTGTAGAGTACTGCTTGCACCGCTTTCTCTTTCACCTCGATGACTAC
CTGCCGGACAACAGGGTCGGCGTGACGATGCACTTCATGCTCCACGGCATCCACCACTACCTGCCGATGGACAAG
TACCGCCTGGTCATGCCGCCCGTGCTCTTCGTCGTTCTCGCGACGCCCTTTTGGCATCTGACCCACGTCATCTTC
TCATGGAGCTGGCACGCCGCCACTGCCGTCTTCTGCGGCGGCATCTTCGGCTACATCTGCTACGACTTGACGCAC
TACTTCCTGCACCACGAGAACCTCCCGCTGTGGTACAAGCAGCTGAAGAAGTACCACCTGCAGCACCACTTCCTC
GACTACGAGCTGGGCTTCGGAGTCACCAGCAAGTTCTGGGACAAAATCTTCGGCACCGAGCTGCAGCCCCCCACC
AAGACCCAGTGA
Transcript >Hirsu2|9729
ATGCCTTCGCGGACGCTGCCGACCTTCACGCGCGCCGAGGTCGAGGCGCACGACTCGGCCGCCTCGTGCTATGTG
ACCATCGGCACCAAGGTGTACGACGTCACCGACTTCGTCCAAGACCACCCGGGCGGCGGCGACCTGCTGCTCGAA
TACGCCGGCCGAGACGTCGAGGATATCCTCAAGGACCCGACCTCGCACCCGCACTCCGAGGCCGCCTACGAGGTC
CTCGACGACTCCTTCGTCGGCTTCGTGCCGCCCGTGAAGGCTGTCGCCGCCAACGGGCATTCCGCGCAGCTGAAT
GGCAACGCCAACGGGACCACCGGTCCCGACTCCGCTACCTACGTGCATCCTCGCACCGGCATGTCGTGCGAAGAG
GACTTATCCAAGGAGACCGACTACAGCAATGATTACAGGAGGCACAAGTTTCTCGACCTCGGCAAGCCCCTCTTC
TTTCAAATCTGGAACGGCGGCTTCAGCAAGGATTTCTACCTGGATCAGGTCCATCGTCCGCGCCACTACAAGGGA
GGCCAGTCGGCGCCCCTGTTCGGCAACTTCCTGGAGCCCCTCACCAAGACACCTTGGTGGATGGTGCCGACCATT
TGGATACCCTGTGTCGCGTACGGCTCCTACCTCGCCGCTCAAGGCTTCAACCATGTCGCTGTCGGGGCCTCGTAC
TGGCTGTTTGGCCTGTTTCTCTGGACCCTTGTAGAGTACTGCTTGCACCGCTTTCTCTTTCACCTCGATGACTAC
CTGCCGGACAACAGGGTCGGCGTGACGATGCACTTCATGCTCCACGGCATCCACCACTACCTGCCGATGGACAAG
TACCGCCTGGTCATGCCGCCCGTGCTCTTCGTCGTTCTCGCGACGCCCTTTTGGCATCTGACCCACGTCATCTTC
TCATGGAGCTGGCACGCCGCCACTGCCGTCTTCTGCGGCGGCATCTTCGGCTACATCTGCTACGACTTGACGCAC
TACTTCCTGCACCACGAGAACCTCCCGCTGTGGTACAAGCAGCTGAAGAAGTACCACCTGCAGCACCACTTCCTC
GACTACGAGCTGGGCTTCGGAGTCACCAGCAAGTTCTGGGACAAAATCTTCGGCACCGAGCTGCAGCCCCCCACC
AAGACCCAGTGA
Gene >Hirsu2|9729
ATGCCTTCGCGGACGCTGCCGACCTTCACGCGCGCCGAGGTCGAGGCGCACGACTCGGCCGCCTCGTGCTATGTG
ACCATCGGCACCAAGGTGTACGACGTCACCGACTTCGTCCAAGACCACCCGGGCGGCGGCGACCTGCTGCTCGAA
TACGCCGGCCGAGACGTCGAGGATATCCTCAAGGACCCGACCTCGCACCCGCACTCCGAGGCCGCCTACGAGGTC
CTCGACGACTCCTTCGTCGGCTTCGTGCCGCCCGTGAAGGCTGTCGCCGCCAACGGGCATTCCGCGCAGCTGAAT
GGCAACGCCAACGGGACCGTCAACGGGACCGCCAACGGGACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGCCAACGGAGCTGCCAACGGGATCGCCAA
CGGGACTGTCAAGACCGGTCCCGACTCCGCTACCTACGTGCATCCTCGCACCGGCATGTCGTGCGAAGAGGACTT
ATCCAAGGAGACCGACTACAGCAATGATTACAGGAGGCACAAGTTTCTCGACCTCGGCAAGCCCCTCTTCTTTCA
AATCTGGAACGGCGGCTTCAGCAAGGATTTCTACCTGGATCAGGTCCATCGTCCGCGCCACTACAAGGGAGGCCA
GTCGGCGCCCCTGTTCGGCAACTTCCTGGAGCCCCTCACCAAGACACCTTGGTGGATGGTGCCGACCATTTGGAT
ACCCTGTGTCGCGTACGGCTCCTACCTCGCCGCTCAAGGCTTCAACCATGTCGCTGTCGGGGCCTCGTACTGGCT
GTTTGGCCTGTTTCTCTGGACCCTTGTAGAGTACTGCTTGCACCGCTTTCTCTTTCACCTCGATGAGTACGTCGA
ATCTGGCTCCCGTCCCCCCTCCTCGCAACGCCCTTTGCTGACCCGCTCCCATCCAGCTACCTGCCGGACAACAGG
GTCGGCGTGACGATGCACTTCATGCTCCACGGCATCCACCACTACCTGCCGATGGACAAGTACCGCCTGGTCATG
CCGCCCGTGCTCTTCGTCGTTCTCGCGACGCCCTTTTGGCATCTGACCCACGTCATCTTCTCATGGAGCTGGCAC
GCCGCCACTGCCGTCTTCTGCGGCGGCATCTTCGGCTACATCTGCTACGACTTGACGCACTACTTCCTGCACCAC
GAGAACCTCCCGCTGTGGTACAAGCAGCTGAAGAAGTACCACCTGCAGCACCACTTCCTCGACTACGAGCTGGGC
TTCGGAGTCACCAGCAAGTTCTGGGACAAAATCTTCGGCACCGAGCTGCAGCCCCCCACCAAGACCCAGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail