Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9728
Gene name
LocationContig_73:5942..7049
Strand+
Gene length (bp)1107
Transcript length (bp)1107
Coding sequence length (bp)1107
Protein length (aa) 369

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family 7.2E-108 35 355

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P21594|PYRF_HYPJE Orotidine 5'-phosphate decarboxylase OS=Hypocrea jecorina GN=ura3 PE=3 SV=1 1 367 0.0E+00
sp|P14017|PYRF_ACRCH Orotidine 5'-phosphate decarboxylase OS=Acremonium chrysogenum GN=PYR4 PE=3 SV=1 1 368 0.0E+00
sp|Q12709|PYRF_HYPAT Orotidine 5'-phosphate decarboxylase OS=Hypocrea atroviridis GN=pyr4 PE=3 SV=1 1 367 0.0E+00
sp|P78748|PYRF_SORMK Orotidine 5'-phosphate decarboxylase OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=URA3 PE=3 SV=2 3 366 1.0E-160
sp|P05035|PYRF_NEUCR Orotidine 5'-phosphate decarboxylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pyr-4 PE=3 SV=1 3 366 1.0E-158
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P21594|PYRF_HYPJE Orotidine 5'-phosphate decarboxylase OS=Hypocrea jecorina GN=ura3 PE=3 SV=1 1 367 0.0E+00
sp|P14017|PYRF_ACRCH Orotidine 5'-phosphate decarboxylase OS=Acremonium chrysogenum GN=PYR4 PE=3 SV=1 1 368 0.0E+00
sp|Q12709|PYRF_HYPAT Orotidine 5'-phosphate decarboxylase OS=Hypocrea atroviridis GN=pyr4 PE=3 SV=1 1 367 0.0E+00
sp|P78748|PYRF_SORMK Orotidine 5'-phosphate decarboxylase OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=URA3 PE=3 SV=2 3 366 1.0E-160
sp|P05035|PYRF_NEUCR Orotidine 5'-phosphate decarboxylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pyr-4 PE=3 SV=1 3 366 1.0E-158
sp|O13416|PYRF_ASPOR Orotidine 5'-phosphate decarboxylase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pyrG PE=3 SV=1 10 154 9.0E-38
sp|Q9P8X9|PYRF_AURPU Orotidine 5'-phosphate decarboxylase OS=Aureobasidium pullulans GN=URA3 PE=3 SV=1 238 363 2.0E-37
sp|Q9P8X9|PYRF_AURPU Orotidine 5'-phosphate decarboxylase OS=Aureobasidium pullulans GN=URA3 PE=3 SV=1 1 147 2.0E-37
sp|O13410|PYRF_ASPFU Orotidine 5'-phosphate decarboxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pyrG PE=3 SV=1 10 154 3.0E-37
sp|Q7Z8L4|PYRF_PENCA Orotidine 5'-phosphate decarboxylase OS=Penicillium camembertii GN=pyrG PE=3 SV=1 10 154 4.0E-37
sp|Q8J269|PYRF_PENNA Orotidine 5'-phosphate decarboxylase OS=Penicillium nalgiovense GN=pyrG PE=3 SV=1 10 154 6.0E-37
sp|Q12604|PYRF_MAGMU Orotidine 5'-phosphate decarboxylase OS=Magnusiomyces magnusii GN=URA3 PE=3 SV=1 1 150 2.0E-36
sp|Q1E9A1|PYRF_COCIM Orotidine 5'-phosphate decarboxylase OS=Coccidioides immitis (strain RS) GN=URA3 PE=3 SV=1 11 146 5.0E-36
sp|Q4VWW3|PYRF_COCPS Orotidine 5'-phosphate decarboxylase OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=URA3 PE=3 SV=1 11 146 5.0E-36
sp|Q9LDN2|UMPS1_ORYSJ Uridine 5'-monophosphate synthase OS=Oryza sativa subsp. japonica GN=UMPS1 PE=2 SV=1 11 141 1.0E-35
sp|Q8RZA1|UMPS2_ORYSJ Uridine 5'-monophosphate synthase OS=Oryza sativa subsp. japonica GN=UMPS2 PE=2 SV=1 6 141 1.0E-35
sp|P07817|PYRF_ASPNG Orotidine 5'-phosphate decarboxylase OS=Aspergillus niger GN=pyrG PE=3 SV=1 10 146 3.0E-35
sp|Q5J2D0|PYRF_ASPAW Orotidine 5'-phosphate decarboxylase OS=Aspergillus awamori GN=pyrG PE=3 SV=1 10 146 3.0E-35
sp|P13439|UMPS_MOUSE Uridine 5'-monophosphate synthase OS=Mus musculus GN=Umps PE=1 SV=3 3 141 4.0E-35
sp|Q9HFV8|PYRF_PASFU Orotidine 5'-phosphate decarboxylase OS=Passalora fulva GN=PYR1 PE=3 SV=1 11 154 6.0E-35
sp|Q9C131|PYRF_PARBR Orotidine 5'-phosphate decarboxylase OS=Paracoccidioides brasiliensis GN=URA3 PE=3 SV=1 11 146 7.0E-35
sp|Q96WP7|PYRF_ASPKA Orotidine 5'-phosphate decarboxylase OS=Aspergillus kawachii GN=pyrG PE=3 SV=1 10 146 9.0E-35
sp|Q42942|UMPS_TOBAC Uridine 5'-monophosphate synthase (Fragment) OS=Nicotiana tabacum GN=PYR5-6 PE=2 SV=1 6 141 1.0E-34
sp|P09463|PYRF_PENCH Orotidine 5'-phosphate decarboxylase OS=Penicillium chrysogenum GN=pyrG PE=3 SV=1 10 154 2.0E-34
sp|Q9C150|PYRF_CANDC Orotidine 5'-phosphate decarboxylase OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=URA3 PE=3 SV=1 10 145 4.0E-34
sp|Q9HF68|PYRF_SOLCC Orotidine 5'-phosphate decarboxylase OS=Solorina crocea GN=PYRG PE=3 SV=1 1 146 5.0E-34
sp|P10652|PYRF_EMENI Orotidine 5'-phosphate decarboxylase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pyrG PE=3 SV=2 11 143 8.0E-34
sp|Q5R514|UMPS_PONAB Uridine 5'-monophosphate synthase OS=Pongo abelii GN=UMPS PE=2 SV=1 10 141 8.0E-34
sp|Q5R514|UMPS_PONAB Uridine 5'-monophosphate synthase OS=Pongo abelii GN=UMPS PE=2 SV=1 230 367 1.0E-33
sp|Q8J0E6|PYRF_TORDE Orotidine 5'-phosphate decarboxylase OS=Torulaspora delbrueckii GN=URA3 PE=3 SV=1 9 145 1.0E-33
sp|P11172|UMPS_HUMAN Uridine 5'-monophosphate synthase OS=Homo sapiens GN=UMPS PE=1 SV=1 230 367 2.0E-33
sp|P13649|PYRF_CANAL Orotidine 5'-phosphate decarboxylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=URA3 PE=3 SV=3 10 145 2.0E-33
sp|P03962|PYRF_YEAST Orotidine 5'-phosphate decarboxylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URA3 PE=1 SV=2 8 145 6.0E-33
sp|P33283|PYRF_CANGA Orotidine 5'-phosphate decarboxylase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=URA3 PE=3 SV=1 9 145 8.0E-33
sp|P49434|PYRF_PICST Orotidine 5'-phosphate decarboxylase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=URA3 PE=3 SV=1 10 145 1.0E-32
sp|P11172|UMPS_HUMAN Uridine 5'-monophosphate synthase OS=Homo sapiens GN=UMPS PE=1 SV=1 10 141 2.0E-32
sp|Q12724|PYRF_YARLI Orotidine 5'-phosphate decarboxylase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=URA3 PE=3 SV=1 10 145 5.0E-32
sp|P31754|UMPS_BOVIN Uridine 5'-monophosphate synthase OS=Bos taurus GN=UMPS PE=2 SV=1 10 141 6.0E-32
sp|Q9Y726|PYRF_SACEX Orotidine 5'-phosphate decarboxylase OS=Saccharomyces exiguus GN=URA4 PE=3 SV=1 9 145 6.0E-32
sp|Q6IUR4|PYRF_CANGY Orotidine 5'-phosphate decarboxylase OS=Candida glycerinogenes GN=URA3 PE=2 SV=1 9 145 7.0E-32
sp|P78724|PYRF_WICAO Orotidine 5'-phosphate decarboxylase OS=Wickerhamomyces anomalus GN=URA3 PE=3 SV=1 10 146 9.0E-32
sp|Q42586|UMPS_ARATH Uridine 5'-monophosphate synthase OS=Arabidopsis thaliana GN=PYRE-F PE=2 SV=2 11 141 1.0E-31
sp|P07922|PYRF_KLULA Orotidine 5'-phosphate decarboxylase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=URA3 PE=3 SV=1 10 145 2.0E-31
sp|P48844|PYRF_KODOH Orotidine 5'-phosphate decarboxylase OS=Kodamaea ohmeri GN=URA3 PE=3 SV=1 10 145 2.0E-31
sp|Q12595|PYRF_CANPA Orotidine 5'-phosphate decarboxylase OS=Candida parapsilosis GN=URA3 PE=3 SV=1 10 145 2.0E-31
sp|O94127|PYRF_CYBJA Orotidine 5'-phosphate decarboxylase OS=Cyberlindnera jadinii GN=URA3 PE=3 SV=1 16 145 4.0E-31
sp|Q01378|PYRF_CANBO Orotidine 5'-phosphate decarboxylase OS=Candida boidinii GN=URA3 PE=3 SV=1 6 145 4.0E-31
sp|Q757S1|PYRF_ASHGO Orotidine 5'-phosphate decarboxylase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=URA3 PE=3 SV=1 10 145 4.0E-31
sp|P31754|UMPS_BOVIN Uridine 5'-monophosphate synthase OS=Bos taurus GN=UMPS PE=2 SV=1 230 367 5.0E-31
sp|P32430|PYRF_CANMA Orotidine 5'-phosphate decarboxylase OS=Candida maltosa GN=URA3 PE=3 SV=1 10 145 9.0E-31
sp|P13439|UMPS_MOUSE Uridine 5'-monophosphate synthase OS=Mus musculus GN=Umps PE=1 SV=3 230 367 1.0E-30
sp|O42771|PYRF_CANTR Orotidine 5'-phosphate decarboxylase OS=Candida tropicalis GN=URA3 PE=3 SV=1 10 145 1.0E-30
sp|Q6BY69|PYRF_DEBHA Orotidine 5'-phosphate decarboxylase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=URA3 PE=3 SV=1 10 145 1.0E-30
sp|Q9HFX0|PYRF_ZYGBA Orotidine 5'-phosphate decarboxylase OS=Zygosaccharomyces bailii GN=URA3 PE=3 SV=1 9 145 2.0E-30
sp|P14965|PYRF_SCHPO Orotidine 5'-phosphate decarboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ura4 PE=3 SV=1 10 141 2.0E-30
sp|P21593|PYRF_PHYB8 Orotidine 5'-phosphate decarboxylase OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=pyrG PE=3 SV=1 10 141 4.0E-30
sp|Q9HFN9|PYRF_CANRU Orotidine 5'-phosphate decarboxylase OS=Candida rugosa GN=URA3 PE=3 SV=1 10 145 5.0E-30
sp|P79075|PYRF_CYBFA Orotidine 5'-phosphate decarboxylase OS=Cyberlindnera fabianii GN=URA3 PE=3 SV=1 10 145 8.0E-30
sp|P32431|PYRF_MUCCL Orotidine 5'-phosphate decarboxylase OS=Mucor circinelloides f. lusitanicus GN=pyrG PE=3 SV=1 10 141 2.0E-29
sp|O93864|PYRF_PACTA Orotidine 5'-phosphate decarboxylase OS=Pachysolen tannophilus GN=URA3 PE=3 SV=1 6 145 3.0E-29
sp|P41769|PYRF_KLUMA Orotidine 5'-phosphate decarboxylase OS=Kluyveromyces marxianus GN=URA3 PE=3 SV=1 10 145 4.0E-29
sp|P14964|PYRF_SCHCO Orotidine 5'-phosphate decarboxylase OS=Schizophyllum commune GN=URA1 PE=3 SV=1 8 143 5.0E-29
sp|Q9UVZ5|PYRF_SACFI Orotidine 5'-phosphate decarboxylase OS=Saccharomycopsis fibuligera GN=URA3 PE=3 SV=1 10 145 6.0E-29
sp|Q06375|PYRF_PICAN Orotidine 5'-phosphate decarboxylase OS=Pichia angusta GN=URA3 PE=3 SV=1 10 145 1.0E-28
sp|Q9LDN2|UMPS1_ORYSJ Uridine 5'-monophosphate synthase OS=Oryza sativa subsp. japonica GN=UMPS1 PE=2 SV=1 238 363 2.0E-28
sp|Q71HN5|PYRF_RHIOR Orotidine 5'-phosphate decarboxylase OS=Rhizopus oryzae GN=pyrG PE=3 SV=1 11 142 2.0E-28
sp|P43230|PYRF_RHINI Orotidine 5'-phosphate decarboxylase OS=Rhizopus niveus GN=PYR4 PE=3 SV=1 11 142 2.0E-28
sp|P21593|PYRF_PHYB8 Orotidine 5'-phosphate decarboxylase OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=pyrG PE=3 SV=1 247 368 1.0E-27
sp|Q01637|UMPS_DROME Uridine 5'-monophosphate synthase OS=Drosophila melanogaster GN=r-l PE=2 SV=2 8 141 2.0E-27
sp|Q42586|UMPS_ARATH Uridine 5'-monophosphate synthase OS=Arabidopsis thaliana GN=PYRE-F PE=2 SV=2 206 366 3.0E-27
sp|P14964|PYRF_SCHCO Orotidine 5'-phosphate decarboxylase OS=Schizophyllum commune GN=URA1 PE=3 SV=1 238 367 4.0E-27
sp|O13410|PYRF_ASPFU Orotidine 5'-phosphate decarboxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pyrG PE=3 SV=1 241 367 9.0E-27
sp|P32431|PYRF_MUCCL Orotidine 5'-phosphate decarboxylase OS=Mucor circinelloides f. lusitanicus GN=pyrG PE=3 SV=1 247 368 9.0E-27
sp|P15188|PYRF_USTMA Orotidine 5'-phosphate decarboxylase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PYR6 PE=2 SV=2 10 144 1.0E-26
sp|Q9C131|PYRF_PARBR Orotidine 5'-phosphate decarboxylase OS=Paracoccidioides brasiliensis GN=URA3 PE=3 SV=1 241 368 2.0E-26
sp|P10652|PYRF_EMENI Orotidine 5'-phosphate decarboxylase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pyrG PE=3 SV=2 241 367 2.0E-26
sp|Q9Y720|PYRF_RHIPU Orotidine 5'-phosphate decarboxylase OS=Rhizomucor pusillus GN=PYR4 PE=3 SV=1 10 141 2.0E-26
sp|Q71HN5|PYRF_RHIOR Orotidine 5'-phosphate decarboxylase OS=Rhizopus oryzae GN=pyrG PE=3 SV=1 247 367 5.0E-26
sp|P43230|PYRF_RHINI Orotidine 5'-phosphate decarboxylase OS=Rhizopus niveus GN=PYR4 PE=3 SV=1 247 367 5.0E-26
sp|Q9UVZ5|PYRF_SACFI Orotidine 5'-phosphate decarboxylase OS=Saccharomycopsis fibuligera GN=URA3 PE=3 SV=1 241 367 6.0E-26
sp|O93864|PYRF_PACTA Orotidine 5'-phosphate decarboxylase OS=Pachysolen tannophilus GN=URA3 PE=3 SV=1 205 367 8.0E-26
sp|Q25566|UMPS_NAEGR Uridine 5'-monophosphate synthase OS=Naegleria gruberi GN=UMP PE=3 SV=1 2 144 1.0E-25
sp|Q1E9A1|PYRF_COCIM Orotidine 5'-phosphate decarboxylase OS=Coccidioides immitis (strain RS) GN=URA3 PE=3 SV=1 241 367 2.0E-25
sp|Q4VWW3|PYRF_COCPS Orotidine 5'-phosphate decarboxylase OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=URA3 PE=3 SV=1 241 367 2.0E-25
sp|P07817|PYRF_ASPNG Orotidine 5'-phosphate decarboxylase OS=Aspergillus niger GN=pyrG PE=3 SV=1 241 367 2.0E-25
sp|Q5J2D0|PYRF_ASPAW Orotidine 5'-phosphate decarboxylase OS=Aspergillus awamori GN=pyrG PE=3 SV=1 241 367 2.0E-25
sp|P33283|PYRF_CANGA Orotidine 5'-phosphate decarboxylase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=URA3 PE=3 SV=1 241 367 2.0E-25
sp|P78724|PYRF_WICAO Orotidine 5'-phosphate decarboxylase OS=Wickerhamomyces anomalus GN=URA3 PE=3 SV=1 241 366 2.0E-25
sp|P41769|PYRF_KLUMA Orotidine 5'-phosphate decarboxylase OS=Kluyveromyces marxianus GN=URA3 PE=3 SV=1 241 367 2.0E-25
sp|Q9C1J2|PYRF_PICPA Orotidine 5'-phosphate decarboxylase OS=Komagataella pastoris GN=URA3 PE=3 SV=1 10 146 2.0E-25
sp|Q8J0E6|PYRF_TORDE Orotidine 5'-phosphate decarboxylase OS=Torulaspora delbrueckii GN=URA3 PE=3 SV=1 241 368 5.0E-25
sp|Q9HFV8|PYRF_PASFU Orotidine 5'-phosphate decarboxylase OS=Passalora fulva GN=PYR1 PE=3 SV=1 241 367 7.0E-25
sp|P07922|PYRF_KLULA Orotidine 5'-phosphate decarboxylase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=URA3 PE=3 SV=1 241 367 8.0E-25
sp|Q7Z8L4|PYRF_PENCA Orotidine 5'-phosphate decarboxylase OS=Penicillium camembertii GN=pyrG PE=3 SV=1 241 367 1.0E-24
sp|P32430|PYRF_CANMA Orotidine 5'-phosphate decarboxylase OS=Candida maltosa GN=URA3 PE=3 SV=1 234 366 1.0E-24
sp|Q9HFX0|PYRF_ZYGBA Orotidine 5'-phosphate decarboxylase OS=Zygosaccharomyces bailii GN=URA3 PE=3 SV=1 241 366 1.0E-24
sp|P79075|PYRF_CYBFA Orotidine 5'-phosphate decarboxylase OS=Cyberlindnera fabianii GN=URA3 PE=3 SV=1 241 368 1.0E-24
sp|P09556|UMPS_DICDI Uridine 5'-monophosphate synthase OS=Dictyostelium discoideum GN=pyr56 PE=1 SV=2 242 363 1.0E-24
sp|Q96WP7|PYRF_ASPKA Orotidine 5'-phosphate decarboxylase OS=Aspergillus kawachii GN=pyrG PE=3 SV=1 241 367 2.0E-24
sp|P09463|PYRF_PENCH Orotidine 5'-phosphate decarboxylase OS=Penicillium chrysogenum GN=pyrG PE=3 SV=1 241 367 2.0E-24
sp|Q9C150|PYRF_CANDC Orotidine 5'-phosphate decarboxylase OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=URA3 PE=3 SV=1 241 366 2.0E-24
sp|Q9Y720|PYRF_RHIPU Orotidine 5'-phosphate decarboxylase OS=Rhizomucor pusillus GN=PYR4 PE=3 SV=1 247 368 2.0E-24
sp|Q8J269|PYRF_PENNA Orotidine 5'-phosphate decarboxylase OS=Penicillium nalgiovense GN=pyrG PE=3 SV=1 241 367 3.0E-24
sp|Q757S1|PYRF_ASHGO Orotidine 5'-phosphate decarboxylase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=URA3 PE=3 SV=1 241 367 3.0E-24
sp|P48844|PYRF_KODOH Orotidine 5'-phosphate decarboxylase OS=Kodamaea ohmeri GN=URA3 PE=3 SV=1 241 368 4.0E-24
sp|O94127|PYRF_CYBJA Orotidine 5'-phosphate decarboxylase OS=Cyberlindnera jadinii GN=URA3 PE=3 SV=1 241 366 4.0E-24
sp|Q6IUR4|PYRF_CANGY Orotidine 5'-phosphate decarboxylase OS=Candida glycerinogenes GN=URA3 PE=2 SV=1 230 368 6.0E-24
sp|Q6BY69|PYRF_DEBHA Orotidine 5'-phosphate decarboxylase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=URA3 PE=3 SV=1 241 366 6.0E-24
sp|P13649|PYRF_CANAL Orotidine 5'-phosphate decarboxylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=URA3 PE=3 SV=3 241 366 1.0E-23
sp|O13416|PYRF_ASPOR Orotidine 5'-phosphate decarboxylase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pyrG PE=3 SV=1 241 367 2.0E-23
sp|P49434|PYRF_PICST Orotidine 5'-phosphate decarboxylase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=URA3 PE=3 SV=1 241 366 2.0E-23
sp|Q12595|PYRF_CANPA Orotidine 5'-phosphate decarboxylase OS=Candida parapsilosis GN=URA3 PE=3 SV=1 211 367 2.0E-23
sp|Q06375|PYRF_PICAN Orotidine 5'-phosphate decarboxylase OS=Pichia angusta GN=URA3 PE=3 SV=1 241 367 2.0E-23
sp|Q9C1J2|PYRF_PICPA Orotidine 5'-phosphate decarboxylase OS=Komagataella pastoris GN=URA3 PE=3 SV=1 241 368 2.0E-23
sp|P09556|UMPS_DICDI Uridine 5'-monophosphate synthase OS=Dictyostelium discoideum GN=pyr56 PE=1 SV=2 11 138 2.0E-23
sp|Q9Y726|PYRF_SACEX Orotidine 5'-phosphate decarboxylase OS=Saccharomyces exiguus GN=URA4 PE=3 SV=1 241 366 3.0E-23
sp|P03962|PYRF_YEAST Orotidine 5'-phosphate decarboxylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URA3 PE=1 SV=2 241 366 5.0E-23
sp|Q01378|PYRF_CANBO Orotidine 5'-phosphate decarboxylase OS=Candida boidinii GN=URA3 PE=3 SV=1 241 366 5.0E-23
sp|O42771|PYRF_CANTR Orotidine 5'-phosphate decarboxylase OS=Candida tropicalis GN=URA3 PE=3 SV=1 241 366 7.0E-23
sp|Q42942|UMPS_TOBAC Uridine 5'-monophosphate synthase (Fragment) OS=Nicotiana tabacum GN=PYR5-6 PE=2 SV=1 247 364 9.0E-23
sp|P14965|PYRF_SCHPO Orotidine 5'-phosphate decarboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ura4 PE=3 SV=1 247 367 3.0E-22
sp|P15188|PYRF_USTMA Orotidine 5'-phosphate decarboxylase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PYR6 PE=2 SV=2 238 367 3.0E-22
sp|Q12604|PYRF_MAGMU Orotidine 5'-phosphate decarboxylase OS=Magnusiomyces magnusii GN=URA3 PE=3 SV=1 233 367 4.0E-22
sp|Q9HF68|PYRF_SOLCC Orotidine 5'-phosphate decarboxylase OS=Solorina crocea GN=PYRG PE=3 SV=1 241 368 2.0E-21
sp|Q9HFN9|PYRF_CANRU Orotidine 5'-phosphate decarboxylase OS=Candida rugosa GN=URA3 PE=3 SV=1 241 367 6.0E-21
sp|Q12724|PYRF_YARLI Orotidine 5'-phosphate decarboxylase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=URA3 PE=3 SV=1 239 363 1.0E-20
sp|Q25566|UMPS_NAEGR Uridine 5'-monophosphate synthase OS=Naegleria gruberi GN=UMP PE=3 SV=1 224 368 2.0E-20
sp|Q8RZA1|UMPS2_ORYSJ Uridine 5'-monophosphate synthase OS=Oryza sativa subsp. japonica GN=UMPS2 PE=2 SV=1 238 363 1.0E-19
sp|Q01637|UMPS_DROME Uridine 5'-monophosphate synthase OS=Drosophila melanogaster GN=r-l PE=2 SV=2 241 367 2.0E-16
[Show less]

GO

GO Term Description Terminal node
GO:0004590 orotidine-5'-phosphate decarboxylase activity Yes
GO:0006207 'de novo' pyrimidine nucleobase biosynthetic process Yes
GO:0071704 organic substance metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0046112 nucleobase biosynthetic process No
GO:0072528 pyrimidine-containing compound biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0019856 pyrimidine nucleobase biosynthetic process No
GO:0016829 lyase activity No
GO:0008150 biological_process No
GO:0046483 heterocycle metabolic process No
GO:0006206 pyrimidine nucleobase metabolic process No
GO:0003674 molecular_function No
GO:0072527 pyrimidine-containing compound metabolic process No
GO:0016831 carboxy-lyase activity No
GO:0009058 biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044281 small molecule metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0003824 catalytic activity No
GO:0044249 cellular biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044237 cellular metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0009112 nucleobase metabolic process No
GO:0016830 carbon-carbon lyase activity No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9728
MAPHPTLKATYDARAETATHPLSAYLFRLIGLKASNLCLSLDVATARELLYLADKLGPSIVVLKTHYDMVSGWDF
HPQTGTGAKLASLARRHGFLIFEDRKFGDIGNTVEMQYVGGSARIIEWAHIVNVNMVPGKASVTSLANAASRWLE
RYPYEVKTSVTVGTPTADEFDDADVGSNRDDDGACAVRDGRRPDEGRKGSIVSVTTVTQQYEPANSPRLAKHLGG
SDEVLFSGIEEAPLTRGLLILAQMSSQGNFMNKEYTQACVEAAREHKDFVMGFVSQESLNSEPEDQFIHMTPGCQ
LPPEDEERNGTAHGDGKGQQYNTPQKIIGLCGADIVIVGRGILKAGDPQEEAERYRSAAWKAYLERVR*
Coding >Hirsu2|9728
ATGGCGCCGCATCCGACGCTCAAGGCGACGTACGACGCGCGGGCAGAGACGGCCACCCACCCCCTCTCCGCCTAC
CTCTTCCGGTTAATAGGCCTCAAGGCGTCGAACCTCTGCCTGAGTCTCGATGTCGCGACGGCGCGCGAGCTCCTG
TACTTGGCCGACAAGCTCGGGCCCTCCATCGTCGTCCTCAAGACGCACTACGACATGGTGTCGGGCTGGGACTTC
CACCCGCAAACAGGTACCGGCGCAAAGCTTGCTTCCCTGGCCCGCAGGCACGGTTTTCTCATCTTTGAGGATCGC
AAGTTCGGCGACATTGGGAACACGGTGGAGATGCAGTACGTCGGCGGCTCCGCTCGCATCATCGAGTGGGCGCAC
ATCGTCAACGTCAACATGGTCCCGGGCAAGGCATCCGTCACCTCGCTTGCCAACGCTGCGTCGCGTTGGCTCGAG
CGGTACCCCTACGAAGTCAAGACGTCGGTCACCGTCGGCACCCCGACCGCCGACGAGTTCGATGACGCCGACGTT
GGCTCGAATCGAGACGACGATGGCGCCTGCGCCGTACGGGACGGCCGTCGACCGGACGAGGGGCGCAAGGGGAGC
ATCGTCTCCGTCACCACCGTCACGCAGCAGTACGAGCCCGCCAACTCCCCCCGCCTGGCCAAGCACCTGGGCGGC
AGCGACGAGGTTCTGTTTTCCGGCATCGAGGAGGCGCCCCTCACCAGGGGTCTGCTGATCTTGGCCCAGATGTCC
AGCCAGGGCAACTTCATGAACAAGGAGTACACGCAAGCCTGCGTCGAGGCGGCCCGCGAGCACAAAGACTTCGTC
ATGGGCTTCGTCTCGCAGGAGAGCCTCAACTCGGAGCCCGAGGATCAGTTCATCCACATGACGCCGGGCTGTCAG
CTGCCGCCCGAGGACGAGGAGCGTAACGGGACGGCGCACGGCGACGGCAAGGGCCAGCAGTATAACACGCCGCAG
AAGATCATCGGACTGTGCGGCGCCGACATTGTCATTGTCGGGCGAGGCATCCTCAAGGCCGGGGACCCGCAAGAG
GAGGCCGAGCGATACCGGTCTGCGGCCTGGAAGGCCTACCTGGAGAGGGTTCGCTGA
Transcript >Hirsu2|9728
ATGGCGCCGCATCCGACGCTCAAGGCGACGTACGACGCGCGGGCAGAGACGGCCACCCACCCCCTCTCCGCCTAC
CTCTTCCGGTTAATAGGCCTCAAGGCGTCGAACCTCTGCCTGAGTCTCGATGTCGCGACGGCGCGCGAGCTCCTG
TACTTGGCCGACAAGCTCGGGCCCTCCATCGTCGTCCTCAAGACGCACTACGACATGGTGTCGGGCTGGGACTTC
CACCCGCAAACAGGTACCGGCGCAAAGCTTGCTTCCCTGGCCCGCAGGCACGGTTTTCTCATCTTTGAGGATCGC
AAGTTCGGCGACATTGGGAACACGGTGGAGATGCAGTACGTCGGCGGCTCCGCTCGCATCATCGAGTGGGCGCAC
ATCGTCAACGTCAACATGGTCCCGGGCAAGGCATCCGTCACCTCGCTTGCCAACGCTGCGTCGCGTTGGCTCGAG
CGGTACCCCTACGAAGTCAAGACGTCGGTCACCGTCGGCACCCCGACCGCCGACGAGTTCGATGACGCCGACGTT
GGCTCGAATCGAGACGACGATGGCGCCTGCGCCGTACGGGACGGCCGTCGACCGGACGAGGGGCGCAAGGGGAGC
ATCGTCTCCGTCACCACCGTCACGCAGCAGTACGAGCCCGCCAACTCCCCCCGCCTGGCCAAGCACCTGGGCGGC
AGCGACGAGGTTCTGTTTTCCGGCATCGAGGAGGCGCCCCTCACCAGGGGTCTGCTGATCTTGGCCCAGATGTCC
AGCCAGGGCAACTTCATGAACAAGGAGTACACGCAAGCCTGCGTCGAGGCGGCCCGCGAGCACAAAGACTTCGTC
ATGGGCTTCGTCTCGCAGGAGAGCCTCAACTCGGAGCCCGAGGATCAGTTCATCCACATGACGCCGGGCTGTCAG
CTGCCGCCCGAGGACGAGGAGCGTAACGGGACGGCGCACGGCGACGGCAAGGGCCAGCAGTATAACACGCCGCAG
AAGATCATCGGACTGTGCGGCGCCGACATTGTCATTGTCGGGCGAGGCATCCTCAAGGCCGGGGACCCGCAAGAG
GAGGCCGAGCGATACCGGTCTGCGGCCTGGAAGGCCTACCTGGAGAGGGTTCGCTGA
Gene >Hirsu2|9728
ATGGCGCCGCATCCGACGCTCAAGGCGACGTACGACGCGCGGGCAGAGACGGCCACCCACCCCCTCTCCGCCTAC
CTCTTCCGGTTAATAGGCCTCAAGGCGTCGAACCTCTGCCTGAGTCTCGATGTCGCGACGGCGCGCGAGCTCCTG
TACTTGGCCGACAAGCTCGGGCCCTCCATCGTCGTCCTCAAGACGCACTACGACATGGTGTCGGGCTGGGACTTC
CACCCGCAAACAGGTACCGGCGCAAAGCTTGCTTCCCTGGCCCGCAGGCACGGTTTTCTCATCTTTGAGGATCGC
AAGTTCGGCGACATTGGGAACACGGTGGAGATGCAGTACGTCGGCGGCTCCGCTCGCATCATCGAGTGGGCGCAC
ATCGTCAACGTCAACATGGTCCCGGGCAAGGCATCCGTCACCTCGCTTGCCAACGCTGCGTCGCGTTGGCTCGAG
CGGTACCCCTACGAAGTCAAGACGTCGGTCACCGTCGGCACCCCGACCGCCGACGAGTTCGATGACGCCGACGTT
GGCTCGAATCGAGACGACGATGGCGCCTGCGCCGTACGGGACGGCCGTCGACCGGACGAGGGGCGCAAGGGGAGC
ATCGTCTCCGTCACCACCGTCACGCAGCAGTACGAGCCCGCCAACTCCCCCCGCCTGGCCAAGCACCTGGGCGGC
AGCGACGAGGTTCTGTTTTCCGGCATCGAGGAGGCGCCCCTCACCAGGGGTCTGCTGATCTTGGCCCAGATGTCC
AGCCAGGGCAACTTCATGAACAAGGAGTACACGCAAGCCTGCGTCGAGGCGGCCCGCGAGCACAAAGACTTCGTC
ATGGGCTTCGTCTCGCAGGAGAGCCTCAACTCGGAGCCCGAGGATCAGTTCATCCACATGACGCCGGGCTGTCAG
CTGCCGCCCGAGGACGAGGAGCGTAACGGGACGGCGCACGGCGACGGCAAGGGCCAGCAGTATAACACGCCGCAG
AAGATCATCGGACTGTGCGGCGCCGACATTGTCATTGTCGGGCGAGGCATCCTCAAGGCCGGGGACCCGCAAGAG
GAGGCCGAGCGATACCGGTCTGCGGCCTGGAAGGCCTACCTGGAGAGGGTTCGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail