Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9716
Gene name
LocationContig_727:7414..8824
Strand+
Gene length (bp)1410
Transcript length (bp)1125
Coding sequence length (bp)1125
Protein length (aa) 375

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00098 zf-CCHC Zinc knuckle 4.7E-05 2 17
PF00098 zf-CCHC Zinc knuckle 7.7E-06 173 188
PF00098 zf-CCHC Zinc knuckle 3.4E-05 200 216
PF00098 zf-CCHC Zinc knuckle 1.6E-03 223 237
PF00098 zf-CCHC Zinc knuckle 5.3E-07 247 262
PF00098 zf-CCHC Zinc knuckle 8.0E-07 267 284
PF00098 zf-CCHC Zinc knuckle 8.7E-07 292 307
PF14392 zf-CCHC_4 Zinc knuckle 7.8E+00 22 38
PF14392 zf-CCHC_4 Zinc knuckle 2.0E-01 170 187
PF14392 zf-CCHC_4 Zinc knuckle 9.6E-02 195 215
PF14392 zf-CCHC_4 Zinc knuckle 1.8E-01 219 238
PF14392 zf-CCHC_4 Zinc knuckle 1.9E+00 267 283
PF14392 zf-CCHC_4 Zinc knuckle 6.0E-01 317 331
PF13917 zf-CCHC_3 Zinc knuckle 2.7E-01 223 238
PF13917 zf-CCHC_3 Zinc knuckle 1.1E-01 269 284
PF13917 zf-CCHC_3 Zinc knuckle 4.4E-01 290 307

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O76743|GLH4_CAEEL ATP-dependent RNA helicase glh-4 OS=Caenorhabditis elegans GN=glh-4 PE=1 SV=2 173 282 1.0E-20
sp|P53849|GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 173 330 3.0E-20
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 171 330 4.0E-17
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 144 307 4.0E-17
sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 191 332 4.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O76743|GLH4_CAEEL ATP-dependent RNA helicase glh-4 OS=Caenorhabditis elegans GN=glh-4 PE=1 SV=2 173 282 1.0E-20
sp|P53849|GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 173 330 3.0E-20
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 171 330 4.0E-17
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 144 307 4.0E-17
sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 191 332 4.0E-17
sp|P53996|CNBP_MOUSE Cellular nucleic acid-binding protein OS=Mus musculus GN=Cnbp PE=1 SV=2 172 308 7.0E-17
sp|Q3T0Q6|CNBP_BOVIN Cellular nucleic acid-binding protein OS=Bos taurus GN=CNBP PE=2 SV=1 173 331 9.0E-17
sp|O42395|CNBP_CHICK Cellular nucleic acid-binding protein OS=Gallus gallus GN=CNBP PE=2 SV=1 173 331 9.0E-17
sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 173 331 1.0E-16
sp|Q5R5R5|CNBP_PONAB Cellular nucleic acid-binding protein OS=Pongo abelii GN=CNBP PE=2 SV=1 172 308 2.0E-16
sp|P62634|CNBP_RAT Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 172 308 2.0E-16
sp|P62633|CNBP_HUMAN Cellular nucleic acid-binding protein OS=Homo sapiens GN=CNBP PE=1 SV=1 172 308 2.0E-16
sp|O65639|CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 173 307 3.0E-16
sp|O42395|CNBP_CHICK Cellular nucleic acid-binding protein OS=Gallus gallus GN=CNBP PE=2 SV=1 172 308 3.0E-16
sp|Q3T0Q6|CNBP_BOVIN Cellular nucleic acid-binding protein OS=Bos taurus GN=CNBP PE=2 SV=1 172 308 4.0E-16
sp|Q5R5R5|CNBP_PONAB Cellular nucleic acid-binding protein OS=Pongo abelii GN=CNBP PE=2 SV=1 173 331 5.0E-16
sp|P62633|CNBP_HUMAN Cellular nucleic acid-binding protein OS=Homo sapiens GN=CNBP PE=1 SV=1 173 331 5.0E-16
sp|P62634|CNBP_RAT Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 173 331 5.0E-16
sp|P53996|CNBP_MOUSE Cellular nucleic acid-binding protein OS=Mus musculus GN=Cnbp PE=1 SV=2 173 331 9.0E-16
sp|O76743|GLH4_CAEEL ATP-dependent RNA helicase glh-4 OS=Caenorhabditis elegans GN=glh-4 PE=1 SV=2 223 336 2.0E-15
sp|P53849|GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 200 330 2.0E-15
sp|Q8T8R1|Y3800_DROME CCHC-type zinc finger protein CG3800 OS=Drosophila melanogaster GN=CG3800 PE=1 SV=1 170 284 3.0E-15
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 168 307 4.0E-15
sp|O65639|CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 173 334 4.0E-15
sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 171 309 9.0E-15
sp|O42395|CNBP_CHICK Cellular nucleic acid-binding protein OS=Gallus gallus GN=CNBP PE=2 SV=1 224 334 1.0E-14
sp|P62633|CNBP_HUMAN Cellular nucleic acid-binding protein OS=Homo sapiens GN=CNBP PE=1 SV=1 155 282 4.0E-14
sp|P62634|CNBP_RAT Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 155 282 4.0E-14
sp|Q5R5R5|CNBP_PONAB Cellular nucleic acid-binding protein OS=Pongo abelii GN=CNBP PE=2 SV=1 155 282 4.0E-14
sp|Q3T0Q6|CNBP_BOVIN Cellular nucleic acid-binding protein OS=Bos taurus GN=CNBP PE=2 SV=1 155 282 5.0E-14
sp|P53996|CNBP_MOUSE Cellular nucleic acid-binding protein OS=Mus musculus GN=Cnbp PE=1 SV=2 224 334 7.0E-14
sp|Q3T0Q6|CNBP_BOVIN Cellular nucleic acid-binding protein OS=Bos taurus GN=CNBP PE=2 SV=1 224 333 1.0E-13
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 1 264 3.0E-13
sp|P62633|CNBP_HUMAN Cellular nucleic acid-binding protein OS=Homo sapiens GN=CNBP PE=1 SV=1 201 334 5.0E-13
sp|Q5R5R5|CNBP_PONAB Cellular nucleic acid-binding protein OS=Pongo abelii GN=CNBP PE=2 SV=1 201 334 5.0E-13
sp|P62634|CNBP_RAT Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 201 334 5.0E-13
sp|O76743|GLH4_CAEEL ATP-dependent RNA helicase glh-4 OS=Caenorhabditis elegans GN=glh-4 PE=1 SV=2 266 332 3.0E-12
sp|Q8WW36|ZCH13_HUMAN Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens GN=ZCCHC13 PE=1 SV=1 200 310 1.0E-11
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 213 314 1.0E-11
sp|O65639|CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 165 262 3.0E-11
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 189 307 4.0E-11
sp|P53849|GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 173 264 2.0E-10
sp|Q65XV7|RFA1C_ORYSJ Replication protein A 70 kDa DNA-binding subunit C OS=Oryza sativa subsp. japonica GN=RPA1C PE=1 SV=1 200 307 6.0E-10
sp|Q3T0Q6|CNBP_BOVIN Cellular nucleic acid-binding protein OS=Bos taurus GN=CNBP PE=2 SV=1 243 334 1.0E-09
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 238 344 2.0E-09
sp|Q8WW36|ZCH13_HUMAN Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens GN=ZCCHC13 PE=1 SV=1 171 266 3.0E-09
sp|Q94C69|CSP3_ARATH Cold shock domain-containing protein 3 OS=Arabidopsis thaliana GN=CSP3 PE=1 SV=1 173 334 5.0E-09
sp|P53849|GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 267 331 1.0E-08
sp|Q9P795|AIR1_SCHPO Protein air1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=air1 PE=1 SV=2 172 309 1.0E-08
sp|Q8WW36|ZCH13_HUMAN Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens GN=ZCCHC13 PE=1 SV=1 173 286 6.0E-08
sp|Q8T8R1|Y3800_DROME CCHC-type zinc finger protein CG3800 OS=Drosophila melanogaster GN=CG3800 PE=1 SV=1 218 330 7.0E-08
sp|Q966L9|GLH2_CAEEL ATP-dependent RNA helicase glh-2 OS=Caenorhabditis elegans GN=glh-2 PE=1 SV=1 173 285 1.0E-07
sp|P27980|POL_SIVVG Gag-Pol polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM3) GN=gag-pol PE=3 SV=2 196 297 2.0E-07
sp|P53849|GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 248 340 3.0E-07
sp|Q12476|AIR2_YEAST Protein AIR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AIR2 PE=1 SV=1 160 287 3.0E-07
sp|P34689|GLH1_CAEEL ATP-dependent RNA helicase glh-1 OS=Caenorhabditis elegans GN=glh-1 PE=1 SV=3 201 285 4.0E-07
sp|P05895|POL_SIVVT Gag-Pol polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM TYO-1) GN=gag-pol PE=3 SV=2 196 259 6.0E-07
sp|P40507|AIR1_YEAST Protein AIR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AIR1 PE=1 SV=1 173 287 8.0E-07
sp|P27980|POL_SIVVG Gag-Pol polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM3) GN=gag-pol PE=3 SV=2 223 306 1.0E-06
sp|P05895|POL_SIVVT Gag-Pol polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM TYO-1) GN=gag-pol PE=3 SV=2 223 306 1.0E-06
sp|Q9P795|AIR1_SCHPO Protein air1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=air1 PE=1 SV=2 244 308 1.0E-06
sp|A1L2T6|ZCHC7_XENLA Zinc finger CCHC domain-containing protein 7 OS=Xenopus laevis GN=zcchc7 PE=2 SV=2 211 340 2.0E-06
sp|P20875|POL_HV1JR Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate JRCSF) GN=gag-pol PE=1 SV=3 223 284 2.0E-06
sp|Q9HFF2|YL92_SCHPO Uncharacterized protein C683.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC683.02c PE=3 SV=1 190 284 2.0E-06
sp|Q9Q720|POL_HV1V9 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype H (isolate VI991) GN=gag-pol PE=3 SV=3 223 306 4.0E-06
sp|Q12476|AIR2_YEAST Protein AIR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AIR2 PE=1 SV=1 247 333 5.0E-06
sp|P12499|POL_HV1Z2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate Z2/CDC-Z34) GN=gag-pol PE=1 SV=3 215 306 5.0E-06
sp|P24740|POL_HV1U4 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype A (isolate U455) GN=gag-pol PE=1 SV=3 223 306 5.0E-06
sp|O12158|POL_HV192 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype C (isolate 92BR025) GN=gag-pol PE=1 SV=2 223 306 5.0E-06
sp|P04589|POL_HV1EL Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate ELI) GN=gag-pol PE=3 SV=3 215 306 6.0E-06
sp|Q8N3Z6|ZCHC7_HUMAN Zinc finger CCHC domain-containing protein 7 OS=Homo sapiens GN=ZCCHC7 PE=1 SV=2 245 333 7.0E-06
sp|P40507|AIR1_YEAST Protein AIR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AIR1 PE=1 SV=1 247 333 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0008270 zinc ion binding Yes
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0046914 transition metal ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Zinc finger, CCHC-type

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9716
MTCRYCKQPGHLVKECPDKPPMVCDNCGQDGHLKNNCENARKINRDHVADMPADTAWAKLVKAVAERDMDDTKEA
VQEYIKAVGDAMTYRELQEALFAQDIKLFLIPIERPLVGVFTNMDLQGNMGKKYSITYRFSETPARPREAESFPE
NRDVLLDRLNDAGEVVDSGRSLCHNCGELGHISKTCPQERVEKPERPKIACSNCGADGHRLRDCPQPRVDKFACK
NCGKSGHKAAECEEPPNLDNVECHKCNQTGHFARDCPDAGPRGCRNCGQEGHIAKECDQPRSMDNVICRNCEKPG
HMSRDCPLPRDWSKVQCSNCQMYGHTKVRCTQLPADSEEFDGGFPAPSGDAPEPVLEQGAGGGDASQSFSGGGW*
Coding >Hirsu2|9716
ATGACTTGCCGGTACTGCAAGCAGCCGGGACACCTCGTCAAGGAATGCCCCGACAAGCCGCCCATGGTGTGTGAC
AACTGTGGCCAGGACGGACATCTGAAGAACAACTGCGAGAATGCTCGCAAGATCAACCGCGATCACGTTGCCGAC
ATGCCTGCCGATACCGCCTGGGCTAAGCTCGTGAAAGCCGTGGCTGAGCGGGACATGGACGATACCAAAGAGGCG
GTTCAGGAGTACATCAAAGCCGTGGGCGATGCTATGACCTACCGAGAACTTCAGGAGGCTCTCTTCGCACAGGAC
ATCAAACTGTTCCTCATACCCATCGAGCGACCGCTAGTCGGCGTGTTCACCAACATGGACCTGCAGGGGAACATG
GGAAAGAAGTACAGCATCACCTACAGATTCTCCGAAACCCCTGCTCGTCCTCGCGAGGCCGAATCCTTCCCAGAG
AATCGTGACGTGCTTCTCGATCGCCTGAACGATGCTGGAGAGGTCGTCGACAGTGGCCGCTCGCTGTGCCATAAC
TGCGGAGAGTTGGGCCACATCTCCAAAACCTGCCCTCAGGAGAGGGTGGAGAAGCCTGAGCGGCCCAAAATTGCG
TGCAGTAACTGCGGAGCAGATGGCCACCGCCTTCGAGACTGTCCGCAGCCCCGAGTTGACAAGTTCGCTTGCAAA
AACTGCGGCAAATCCGGCCACAAGGCCGCCGAATGCGAAGAACCCCCGAATCTCGACAACGTCGAATGTCACAAG
TGCAATCAGACGGGGCACTTCGCCCGCGATTGTCCTGACGCTGGCCCTCGCGGATGCCGCAACTGCGGCCAGGAA
GGCCATATTGCCAAGGAGTGCGACCAGCCTCGGAGCATGGACAACGTTATCTGTCGAAACTGTGAGAAGCCAGGA
CATATGAGCAGGGATTGTCCGCTGCCCAGGGATTGGTCCAAGGTGCAGTGCAGCAACTGCCAGATGTACGGGCAC
ACCAAGGTTCGCTGCACACAGCTTCCCGCCGACTCAGAGGAGTTCGATGGCGGGTTCCCGGCGCCTTCAGGCGAC
GCTCCCGAACCCGTTTTGGAGCAAGGCGCGGGCGGGGGGGACGCCTCGCAGTCCTTCAGTGGTGGGGGATGGTAG
Transcript >Hirsu2|9716
ATGACTTGCCGGTACTGCAAGCAGCCGGGACACCTCGTCAAGGAATGCCCCGACAAGCCGCCCATGGTGTGTGAC
AACTGTGGCCAGGACGGACATCTGAAGAACAACTGCGAGAATGCTCGCAAGATCAACCGCGATCACGTTGCCGAC
ATGCCTGCCGATACCGCCTGGGCTAAGCTCGTGAAAGCCGTGGCTGAGCGGGACATGGACGATACCAAAGAGGCG
GTTCAGGAGTACATCAAAGCCGTGGGCGATGCTATGACCTACCGAGAACTTCAGGAGGCTCTCTTCGCACAGGAC
ATCAAACTGTTCCTCATACCCATCGAGCGACCGCTAGTCGGCGTGTTCACCAACATGGACCTGCAGGGGAACATG
GGAAAGAAGTACAGCATCACCTACAGATTCTCCGAAACCCCTGCTCGTCCTCGCGAGGCCGAATCCTTCCCAGAG
AATCGTGACGTGCTTCTCGATCGCCTGAACGATGCTGGAGAGGTCGTCGACAGTGGCCGCTCGCTGTGCCATAAC
TGCGGAGAGTTGGGCCACATCTCCAAAACCTGCCCTCAGGAGAGGGTGGAGAAGCCTGAGCGGCCCAAAATTGCG
TGCAGTAACTGCGGAGCAGATGGCCACCGCCTTCGAGACTGTCCGCAGCCCCGAGTTGACAAGTTCGCTTGCAAA
AACTGCGGCAAATCCGGCCACAAGGCCGCCGAATGCGAAGAACCCCCGAATCTCGACAACGTCGAATGTCACAAG
TGCAATCAGACGGGGCACTTCGCCCGCGATTGTCCTGACGCTGGCCCTCGCGGATGCCGCAACTGCGGCCAGGAA
GGCCATATTGCCAAGGAGTGCGACCAGCCTCGGAGCATGGACAACGTTATCTGTCGAAACTGTGAGAAGCCAGGA
CATATGAGCAGGGATTGTCCGCTGCCCAGGGATTGGTCCAAGGTGCAGTGCAGCAACTGCCAGATGTACGGGCAC
ACCAAGGTTCGCTGCACACAGCTTCCCGCCGACTCAGAGGAGTTCGATGGCGGGTTCCCGGCGCCTTCAGGCGAC
GCTCCCGAACCCGTTTTGGAGCAAGGCGCGGGCGGGGGGGACGCCTCGCAGTCCTTCAGTGGTGGGGGATGGTAG
Gene >Hirsu2|9716
ATGACTTGCCGGTACTGCAAGCAGCCGGGACACCTCGTCAAGGAATGCCCCGACAAGCCGCCCATGGTGTGTGAC
AACTGTGGCCAGGACGGTAGGCTCATTTGTTGGAACAGCTTCTGCTCGCCTGCTGACAAACGTAGGACATCTGAA
GAACAACTGCGAGAATGCTCGCAAGATCAACCGCGATCACGTTGCCGACATGCCTGCCGATACCGCCTGGGCTAA
GCTCGTGAAAGCCGTGGCTGAGCGGGACATGGACGATACCAAAGAGGCGGTTCAGGAGTACATCAAAGCCGTGGG
CGATGCTATGACCTACCGAGAACTTCAGGAGGCTCTCTTCGCACAGGACATCAAACTGTTCCTCATACCCATCGA
GCGACCGCTAGTCGGCGTGTTCACCAACATGGACCTGCAGGGGAACATGGGAAAGAAGTACAGCATCACCTACAG
ATTCTCCGAAACCCCTGCTCGTCCTCGCGAGGCCGAATCCTTCCCAGAGAATCGTGACGTGCTTCTCGATCGCCT
GAACGATGCTGGAGAGGTCGTCGACAGTGGCCGCTCGCTGTGCCATAACTGCGGAGAGTTGGGCCACATCTCCAA
AACCTGCCCTCAGGAGAGGGTGGAGAAGCCTGAGCGGCCCAAAATTGCGTGCAGTAACTGCGGAGCAGATGGCCA
CCGCCTTCGAGACTGTAAGGGTGTCTAGACTTTCTCTCAAGCCTGGCCACTGGGTTGACTGTTTGATTACAGGTC
CGCAGCCCCGAGTTGACAAGTTCGCTTGCAAAAACTGCGGGTAGGTCGTCCGGTCCTGTCGTGTTTCTGTCTGCA
GCTGCCGACCTTTGGAGCTCTGGTGCTGACATGTCGGTAGCAAATCCGGCCACAAGGCCGCCGAATGCGAAGAAC
CCCCGAATCTCGACAACGTCGAATGTCACAAGTGCAATCAGAGTGAGTCCGACCCGTCAGGTGCCCGGATTGGAG
GTAGGCACTGACATGACCCAGCGGGGCACTTCGCCCGCGATTGTCCTGACGCTGGCCCTCGCGGATGCCGCAACT
GCGGCCAGGAAGGCCATATTGCCAAGGAGTGCGACCAGCCTCGGAGCATGGACAACGTTATCTGTCGAAACTGTG
AGAAGCCAGGACATATGAGCAGGGATTGTCCGCTGCCCAGGGATTGTGAGTTTACCTGATCCATGTCTCTGGCTC
ACATCTAACAGAGTTCCAGGGTCCAAGGTGCAGTGCAGCAACTGCCAGATGTACGGGCACACCAAGGTTCGCTGC
ACACAGCTTCCCGCCGACTCAGAGGAGTTCGATGGCGGGTTCCCGGCGCCTTCAGGCGACGCTCCCGAACCCGTT
TTGGAGCAAGGCGCGGGCGGGGGGGACGCCTCGCAGTCCTTCAGTGGTGGGGGATGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail