Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9715
Gene name
LocationContig_727:4540..5314
Strand+
Gene length (bp)774
Transcript length (bp)705
Coding sequence length (bp)705
Protein length (aa) 235

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10503 Esterase_phd Esterase PHB depolymerase 7.8E-08 1 115
PF02230 Abhydrolase_2 Phospholipase/Carboxylesterase 4.7E-05 61 149

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y871|FAEB_PIREQ Feruloyl esterase B OS=Piromyces equi GN=ESTA PE=2 SV=1 2 189 8.0E-17
sp|B8YG19|XS20E_NEOPA Bifunctional acetylxylan esterase/xylanase XynS20E OS=Neocallimastix patriciarum GN=xynS20E PE=1 SV=1 2 210 3.0E-16
sp|A1CC33|FAEC2_ASPCL Probable feruloyl esterase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=faeC-2 PE=3 SV=1 33 184 3.0E-11
sp|A1C9D4|FAEC1_ASPCL Probable feruloyl esterase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=faeC-1 PE=3 SV=1 3 152 3.0E-10
sp|A1DI08|FAEC_NEOFI Probable feruloyl esterase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=faeC PE=3 SV=1 33 186 7.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y871|FAEB_PIREQ Feruloyl esterase B OS=Piromyces equi GN=ESTA PE=2 SV=1 2 189 8.0E-17
sp|B8YG19|XS20E_NEOPA Bifunctional acetylxylan esterase/xylanase XynS20E OS=Neocallimastix patriciarum GN=xynS20E PE=1 SV=1 2 210 3.0E-16
sp|A1CC33|FAEC2_ASPCL Probable feruloyl esterase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=faeC-2 PE=3 SV=1 33 184 3.0E-11
sp|A1C9D4|FAEC1_ASPCL Probable feruloyl esterase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=faeC-1 PE=3 SV=1 3 152 3.0E-10
sp|A1DI08|FAEC_NEOFI Probable feruloyl esterase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=faeC PE=3 SV=1 33 186 7.0E-10
sp|A4D9B6|FAEC_ASPFU Probable feruloyl esterase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=faeC PE=3 SV=1 33 151 2.0E-09
sp|B0XU32|FAEC_ASPFC Probable feruloyl esterase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=faeC PE=3 SV=1 33 151 2.0E-09
sp|A2QYU7|FAEC_ASPNC Probable feruloyl esterase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=faeC PE=3 SV=1 33 151 6.0E-09
sp|Q0CDX2|FAEC_ASPTN Probable feruloyl esterase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=faeC PE=3 SV=1 33 150 1.0E-08
sp|Q5B2G3|FAEC_EMENI Feruloyl esterase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=faeC PE=1 SV=1 33 151 1.0E-07
sp|Q2UI81|FAEC_ASPOR Probable feruloyl esterase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=faeC PE=3 SV=2 33 174 2.0E-07
sp|B8N7Z6|FAEC_ASPFN Probable feruloyl esterase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=faeC PE=3 SV=1 33 174 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005576 extracellular region Yes
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9715
MPLLVAYHGAGGNPQEFEENTGFSDASINPDMITVYPAGISKSWQGAAYAAAGVNDEAFTTDLIDRILKEYCIDE
SRMYAAGFSNGGGFVGTLACSHDHGGRFAAFAAVSGAFYTSEEGLQGMACRPARLPVPILEVHGTDDKTVPYAGG
TGRGGRLDPIPTWLSHWAERNKCKTPATNSSRDGIHHFQWPCETSDGLLRHFKIEGHGHSWPKKDKKINISPIII
DFLSAHRYS*
Coding >Hirsu2|9715
ATGCCTCTCCTGGTCGCTTATCACGGGGCTGGGGGTAATCCCCAGGAGTTCGAAGAAAACACCGGCTTCTCTGAT
GCGTCCATCAACCCCGACATGATTACCGTCTACCCTGCCGGCATCTCGAAATCGTGGCAGGGTGCTGCTTATGCT
GCGGCGGGGGTGAACGATGAGGCGTTCACGACGGACCTCATAGATCGCATACTAAAAGAATATTGCATCGACGAA
TCGCGGATGTACGCCGCCGGCTTCTCCAACGGCGGCGGCTTCGTCGGCACCTTGGCATGTTCGCACGACCATGGG
GGCCGTTTCGCTGCTTTTGCGGCCGTGTCCGGCGCCTTTTACACCAGCGAGGAAGGCCTTCAAGGCATGGCCTGT
CGCCCAGCCCGCTTGCCCGTCCCAATCCTGGAGGTGCACGGGACGGACGATAAGACGGTTCCTTACGCGGGTGGG
ACAGGGCGAGGAGGCCGTCTCGACCCAATTCCAACATGGCTTTCGCATTGGGCGGAGAGGAACAAGTGCAAGACG
CCAGCTACGAACAGCTCTAGAGACGGAATCCACCACTTCCAGTGGCCATGTGAAACGAGTGACGGTCTTCTGCGG
CACTTCAAAATCGAGGGGCACGGCCACAGCTGGCCAAAGAAGGATAAGAAGATCAATATATCACCCATAATCATC
GACTTTCTTTCTGCTCATCGCTATTCTTAG
Transcript >Hirsu2|9715
ATGCCTCTCCTGGTCGCTTATCACGGGGCTGGGGGTAATCCCCAGGAGTTCGAAGAAAACACCGGCTTCTCTGAT
GCGTCCATCAACCCCGACATGATTACCGTCTACCCTGCCGGCATCTCGAAATCGTGGCAGGGTGCTGCTTATGCT
GCGGCGGGGGTGAACGATGAGGCGTTCACGACGGACCTCATAGATCGCATACTAAAAGAATATTGCATCGACGAA
TCGCGGATGTACGCCGCCGGCTTCTCCAACGGCGGCGGCTTCGTCGGCACCTTGGCATGTTCGCACGACCATGGG
GGCCGTTTCGCTGCTTTTGCGGCCGTGTCCGGCGCCTTTTACACCAGCGAGGAAGGCCTTCAAGGCATGGCCTGT
CGCCCAGCCCGCTTGCCCGTCCCAATCCTGGAGGTGCACGGGACGGACGATAAGACGGTTCCTTACGCGGGTGGG
ACAGGGCGAGGAGGCCGTCTCGACCCAATTCCAACATGGCTTTCGCATTGGGCGGAGAGGAACAAGTGCAAGACG
CCAGCTACGAACAGCTCTAGAGACGGAATCCACCACTTCCAGTGGCCATGTGAAACGAGTGACGGTCTTCTGCGG
CACTTCAAAATCGAGGGGCACGGCCACAGCTGGCCAAAGAAGGATAAGAAGATCAATATATCACCCATAATCATC
GACTTTCTTTCTGCTCATCGCTATTCTTAG
Gene >Hirsu2|9715
ATGCCTCTCCTGGTCGCTTATCACGGGGCTGGGGGTAATCCCCAGGAGTTCGAAGAAAACACCGGCTTCTCTGAT
GCGTCCATCAACCCCGACATGATTACCGTCTACCCTGCCGGCATCTCGGTACGGGCTCCTCAATCTGACCGTTCC
TATCTGATGACGCTCCCGCAGACATTAATTGATTGAGCCTAGAAATCGTGGCAGGGTGCTGCTTATGCTGCGGCG
GGGGTGAACGATGAGGCGTTCACGACGGACCTCATAGATCGCATACTAAAAGAATATTGCATCGACGAATCGCGG
ATGTACGCCGCCGGCTTCTCCAACGGCGGCGGCTTCGTCGGCACCTTGGCATGTTCGCACGACCATGGGGGCCGT
TTCGCTGCTTTTGCGGCCGTGTCCGGCGCCTTTTACACCAGCGAGGAAGGCCTTCAAGGCATGGCCTGTCGCCCA
GCCCGCTTGCCCGTCCCAATCCTGGAGGTGCACGGGACGGACGATAAGACGGTTCCTTACGCGGGTGGGACAGGG
CGAGGAGGCCGTCTCGACCCAATTCCAACATGGCTTTCGCATTGGGCGGAGAGGAACAAGTGCAAGACGCCAGCT
ACGAACAGCTCTAGAGACGGAATCCACCACTTCCAGTGGCCATGTGAAACGAGTGACGGTCTTCTGCGGCACTTC
AAAATCGAGGGGCACGGCCACAGCTGGCCAAAGAAGGATAAGAAGATCAATATATCACCCATAATCATCGACTTT
CTTTCTGCTCATCGCTATTCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail