Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|971
Gene name
LocationContig_120:21247..23497
Strand+
Gene length (bp)2250
Transcript length (bp)2250
Coding sequence length (bp)2250
Protein length (aa) 750

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00668 Condensation Condensation domain 1.0E-16 309 579
PF00550 PP-binding Phosphopantetheine attachment site 4.2E-06 200 265

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2 706 6.0E-46
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 223 648 4.0E-19
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 198 599 3.0E-17
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 208 732 3.0E-12
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 223 496 2.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2 706 6.0E-46
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 223 648 4.0E-19
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 198 599 3.0E-17
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 208 732 3.0E-12
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 223 496 2.0E-11
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 210 497 2.0E-11
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 219 517 3.0E-10
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 219 630 2.0E-09
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 221 611 3.0E-09
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 107 575 4.0E-08
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 217 502 4.0E-08
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 225 704 1.0E-07
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 172 548 6.0E-06
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 219 631 8.0E-06
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 219 631 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|971
MVGPTINTVPMRIKLADQGGSAVNVAQALAQVQKLSDDARGTDAMASLRMIQTAWRSSSRDPEHVPASLFQSLFV
FDGIIAPEEVDSDGQAQPLFRPVQIVDGDSGDGPAYDDYPLIVSFHIKNNTLHGKLRAKMTTEKVEALGGRLEAA
VRCVVSCGLQRPALDVGHMETIRQKLAMDEKAANGKVDQAEMVSQAPTADAVLEVVKKVLGARCRGKDIGYNTKL
VNVGLDSILAIRLSQLLRKQMGIGTSVFEMIKGASVHDIVKRSTSTRKVAAQQPRQELLAQKEWLKELVAKELGL
ARELVNSVLPVLAGQRTHLEQWMYNGKRFFEAPWVYRVDDSVDAQRVASCWAELCRVHDILRTTFVWADKTTGLV
QVTLVEHGAGQERFAVLQDSSKTIQALISQHVGEENGKPSNLREPPARLSFLDGLDGKAVVLRVHHALYDAWSIK
MIQRDLDKLLASGKVLRPREPLQDVVRQIRDMRQLDAEESYWKHHLSHAQDTVLHDASTASSSASPLGPHFKASH
PALVPQKTADALGGSARVSAAIILAYARALGRLTKRARPTFGLNHASRSLESADGARTLDLTAASVPTLTVTPFC
LDLGASSSSSEEQWLGRVQDQLAQLARFAQADSAQRLGPRFNSYLNILHRGAEADDDATFTALRRHRLGEPLASA
YFTAAAPSSAPSTIEQLETSHLCPHRLFFNVVVHQGQGIGATVGGDVELSGVAAELVSRFREELVRVVEGSVCG*
Coding >Hirsu2|971
ATGGTCGGCCCCACGATCAACACGGTGCCCATGCGCATCAAGCTGGCGGATCAGGGGGGAAGCGCCGTCAATGTT
GCACAGGCTTTGGCCCAGGTGCAGAAGCTGAGCGACGACGCGAGAGGGACGGATGCGATGGCATCTCTGAGGATG
ATCCAGACGGCGTGGAGATCGTCCAGTCGGGACCCGGAACATGTTCCGGCGAGTCTTTTCCAAAGTCTGTTCGTT
TTTGATGGCATAATCGCCCCCGAAGAGGTCGACAGTGACGGCCAAGCACAGCCGTTGTTCAGGCCCGTTCAGATC
GTCGACGGAGACTCTGGTGATGGGCCCGCGTATGACGACTACCCTCTAATTGTCAGCTTCCATATCAAGAACAAC
ACCCTTCACGGCAAGCTGAGAGCCAAGATGACCACAGAGAAGGTGGAAGCTTTGGGGGGCCGGTTGGAGGCTGCG
GTGAGATGCGTCGTCTCGTGTGGGTTGCAAAGGCCGGCACTGGACGTCGGCCACATGGAAACGATAAGACAGAAG
TTGGCGATGGACGAAAAGGCCGCAAATGGGAAGGTCGATCAAGCAGAGATGGTCAGCCAAGCTCCGACGGCCGAT
GCTGTGTTAGAAGTGGTTAAGAAGGTGCTCGGGGCACGGTGCAGAGGCAAAGACATCGGCTACAACACGAAGCTG
GTCAACGTGGGACTCGACTCGATCTTGGCCATTCGGCTGTCACAGCTCCTGAGAAAGCAGATGGGCATCGGTACC
AGCGTGTTCGAGATGATCAAAGGCGCCAGCGTCCACGACATCGTCAAGAGATCGACGTCGACTCGAAAGGTCGCG
GCACAGCAGCCGAGACAAGAGCTGTTGGCTCAGAAGGAATGGTTGAAGGAGCTTGTGGCCAAGGAACTCGGACTG
GCCAGAGAGCTCGTCAATTCAGTCCTGCCAGTCCTAGCGGGCCAGCGCACGCACTTGGAGCAGTGGATGTACAAC
GGCAAGCGATTCTTCGAGGCCCCGTGGGTGTACCGGGTTGACGATTCCGTTGACGCCCAGAGAGTGGCGAGTTGC
TGGGCTGAGCTCTGCCGCGTTCACGACATCCTCCGAACGACGTTCGTCTGGGCAGACAAGACCACGGGACTGGTC
CAAGTCACGCTGGTCGAGCATGGCGCCGGACAGGAGCGCTTTGCGGTGCTTCAAGACTCGTCCAAGACCATCCAG
GCCTTGATAAGCCAGCACGTGGGCGAGGAGAACGGCAAGCCGTCGAATCTGAGGGAGCCCCCGGCCCGCCTCTCG
TTCCTGGACGGCCTGGACGGGAAAGCAGTCGTGCTTCGGGTCCACCACGCGCTATACGACGCATGGAGCATCAAG
ATGATCCAGAGGGACTTGGACAAGCTCCTGGCCTCGGGCAAGGTGCTGCGCCCGCGCGAGCCTCTACAGGACGTG
GTCCGTCAAATCAGGGACATGCGACAGCTCGACGCCGAGGAGTCATACTGGAAGCACCACCTGTCACATGCTCAA
GACACCGTCCTGCACGATGCATCGACAGCGTCCTCGAGCGCGTCCCCGCTGGGCCCGCACTTCAAAGCCAGCCAT
CCGGCCCTCGTGCCGCAGAAGACGGCCGACGCGCTCGGCGGCAGCGCCCGCGTCTCGGCCGCCATCATCCTCGCC
TACGCGCGGGCGCTGGGCCGCCTCACGAAGCGCGCCCGGCCGACCTTCGGGCTGAACCACGCGTCACGCTCGCTC
GAGTCCGCCGACGGCGCGCGGACGCTCGACCTCACGGCCGCCAGCGTCCCGACCTTGACCGTCACACCCTTCTGC
CTCGACCTCGGCGCCTCGTCGTCGTCGTCCGAGGAGCAGTGGCTGGGCCGGGTGCAGGACCAGCTGGCGCAGCTG
GCCCGGTTCGCACAGGCGGACAGCGCGCAGCGCCTCGGCCCCCGCTTCAACTCGTACCTCAACATCCTCCATCGC
GGAGCCGAGGCCGACGACGACGCGACCTTCACGGCGCTCCGCAGGCACAGACTCGGCGAGCCGCTCGCTTCGGCG
TACTTCACCGCCGCCGCGCCGTCGTCCGCGCCGTCCACGATCGAGCAGCTCGAGACTTCGCACCTGTGTCCGCAC
CGGCTCTTCTTCAACGTTGTCGTCCATCAGGGGCAGGGCATCGGCGCGACGGTGGGCGGTGATGTCGAGCTATCT
GGCGTGGCTGCGGAGCTTGTCTCGCGTTTCCGGGAGGAGCTGGTCAGGGTGGTCGAGGGCAGCGTGTGCGGGTGA
Transcript >Hirsu2|971
ATGGTCGGCCCCACGATCAACACGGTGCCCATGCGCATCAAGCTGGCGGATCAGGGGGGAAGCGCCGTCAATGTT
GCACAGGCTTTGGCCCAGGTGCAGAAGCTGAGCGACGACGCGAGAGGGACGGATGCGATGGCATCTCTGAGGATG
ATCCAGACGGCGTGGAGATCGTCCAGTCGGGACCCGGAACATGTTCCGGCGAGTCTTTTCCAAAGTCTGTTCGTT
TTTGATGGCATAATCGCCCCCGAAGAGGTCGACAGTGACGGCCAAGCACAGCCGTTGTTCAGGCCCGTTCAGATC
GTCGACGGAGACTCTGGTGATGGGCCCGCGTATGACGACTACCCTCTAATTGTCAGCTTCCATATCAAGAACAAC
ACCCTTCACGGCAAGCTGAGAGCCAAGATGACCACAGAGAAGGTGGAAGCTTTGGGGGGCCGGTTGGAGGCTGCG
GTGAGATGCGTCGTCTCGTGTGGGTTGCAAAGGCCGGCACTGGACGTCGGCCACATGGAAACGATAAGACAGAAG
TTGGCGATGGACGAAAAGGCCGCAAATGGGAAGGTCGATCAAGCAGAGATGGTCAGCCAAGCTCCGACGGCCGAT
GCTGTGTTAGAAGTGGTTAAGAAGGTGCTCGGGGCACGGTGCAGAGGCAAAGACATCGGCTACAACACGAAGCTG
GTCAACGTGGGACTCGACTCGATCTTGGCCATTCGGCTGTCACAGCTCCTGAGAAAGCAGATGGGCATCGGTACC
AGCGTGTTCGAGATGATCAAAGGCGCCAGCGTCCACGACATCGTCAAGAGATCGACGTCGACTCGAAAGGTCGCG
GCACAGCAGCCGAGACAAGAGCTGTTGGCTCAGAAGGAATGGTTGAAGGAGCTTGTGGCCAAGGAACTCGGACTG
GCCAGAGAGCTCGTCAATTCAGTCCTGCCAGTCCTAGCGGGCCAGCGCACGCACTTGGAGCAGTGGATGTACAAC
GGCAAGCGATTCTTCGAGGCCCCGTGGGTGTACCGGGTTGACGATTCCGTTGACGCCCAGAGAGTGGCGAGTTGC
TGGGCTGAGCTCTGCCGCGTTCACGACATCCTCCGAACGACGTTCGTCTGGGCAGACAAGACCACGGGACTGGTC
CAAGTCACGCTGGTCGAGCATGGCGCCGGACAGGAGCGCTTTGCGGTGCTTCAAGACTCGTCCAAGACCATCCAG
GCCTTGATAAGCCAGCACGTGGGCGAGGAGAACGGCAAGCCGTCGAATCTGAGGGAGCCCCCGGCCCGCCTCTCG
TTCCTGGACGGCCTGGACGGGAAAGCAGTCGTGCTTCGGGTCCACCACGCGCTATACGACGCATGGAGCATCAAG
ATGATCCAGAGGGACTTGGACAAGCTCCTGGCCTCGGGCAAGGTGCTGCGCCCGCGCGAGCCTCTACAGGACGTG
GTCCGTCAAATCAGGGACATGCGACAGCTCGACGCCGAGGAGTCATACTGGAAGCACCACCTGTCACATGCTCAA
GACACCGTCCTGCACGATGCATCGACAGCGTCCTCGAGCGCGTCCCCGCTGGGCCCGCACTTCAAAGCCAGCCAT
CCGGCCCTCGTGCCGCAGAAGACGGCCGACGCGCTCGGCGGCAGCGCCCGCGTCTCGGCCGCCATCATCCTCGCC
TACGCGCGGGCGCTGGGCCGCCTCACGAAGCGCGCCCGGCCGACCTTCGGGCTGAACCACGCGTCACGCTCGCTC
GAGTCCGCCGACGGCGCGCGGACGCTCGACCTCACGGCCGCCAGCGTCCCGACCTTGACCGTCACACCCTTCTGC
CTCGACCTCGGCGCCTCGTCGTCGTCGTCCGAGGAGCAGTGGCTGGGCCGGGTGCAGGACCAGCTGGCGCAGCTG
GCCCGGTTCGCACAGGCGGACAGCGCGCAGCGCCTCGGCCCCCGCTTCAACTCGTACCTCAACATCCTCCATCGC
GGAGCCGAGGCCGACGACGACGCGACCTTCACGGCGCTCCGCAGGCACAGACTCGGCGAGCCGCTCGCTTCGGCG
TACTTCACCGCCGCCGCGCCGTCGTCCGCGCCGTCCACGATCGAGCAGCTCGAGACTTCGCACCTGTGTCCGCAC
CGGCTCTTCTTCAACGTTGTCGTCCATCAGGGGCAGGGCATCGGCGCGACGGTGGGCGGTGATGTCGAGCTATCT
GGCGTGGCTGCGGAGCTTGTCTCGCGTTTCCGGGAGGAGCTGGTCAGGGTGGTCGAGGGCAGCGTGTGCGGGTGA
Gene >Hirsu2|971
ATGGTCGGCCCCACGATCAACACGGTGCCCATGCGCATCAAGCTGGCGGATCAGGGGGGAAGCGCCGTCAATGTT
GCACAGGCTTTGGCCCAGGTGCAGAAGCTGAGCGACGACGCGAGAGGGACGGATGCGATGGCATCTCTGAGGATG
ATCCAGACGGCGTGGAGATCGTCCAGTCGGGACCCGGAACATGTTCCGGCGAGTCTTTTCCAAAGTCTGTTCGTT
TTTGATGGCATAATCGCCCCCGAAGAGGTCGACAGTGACGGCCAAGCACAGCCGTTGTTCAGGCCCGTTCAGATC
GTCGACGGAGACTCTGGTGATGGGCCCGCGTATGACGACTACCCTCTAATTGTCAGCTTCCATATCAAGAACAAC
ACCCTTCACGGCAAGCTGAGAGCCAAGATGACCACAGAGAAGGTGGAAGCTTTGGGGGGCCGGTTGGAGGCTGCG
GTGAGATGCGTCGTCTCGTGTGGGTTGCAAAGGCCGGCACTGGACGTCGGCCACATGGAAACGATAAGACAGAAG
TTGGCGATGGACGAAAAGGCCGCAAATGGGAAGGTCGATCAAGCAGAGATGGTCAGCCAAGCTCCGACGGCCGAT
GCTGTGTTAGAAGTGGTTAAGAAGGTGCTCGGGGCACGGTGCAGAGGCAAAGACATCGGCTACAACACGAAGCTG
GTCAACGTGGGACTCGACTCGATCTTGGCCATTCGGCTGTCACAGCTCCTGAGAAAGCAGATGGGCATCGGTACC
AGCGTGTTCGAGATGATCAAAGGCGCCAGCGTCCACGACATCGTCAAGAGATCGACGTCGACTCGAAAGGTCGCG
GCACAGCAGCCGAGACAAGAGCTGTTGGCTCAGAAGGAATGGTTGAAGGAGCTTGTGGCCAAGGAACTCGGACTG
GCCAGAGAGCTCGTCAATTCAGTCCTGCCAGTCCTAGCGGGCCAGCGCACGCACTTGGAGCAGTGGATGTACAAC
GGCAAGCGATTCTTCGAGGCCCCGTGGGTGTACCGGGTTGACGATTCCGTTGACGCCCAGAGAGTGGCGAGTTGC
TGGGCTGAGCTCTGCCGCGTTCACGACATCCTCCGAACGACGTTCGTCTGGGCAGACAAGACCACGGGACTGGTC
CAAGTCACGCTGGTCGAGCATGGCGCCGGACAGGAGCGCTTTGCGGTGCTTCAAGACTCGTCCAAGACCATCCAG
GCCTTGATAAGCCAGCACGTGGGCGAGGAGAACGGCAAGCCGTCGAATCTGAGGGAGCCCCCGGCCCGCCTCTCG
TTCCTGGACGGCCTGGACGGGAAAGCAGTCGTGCTTCGGGTCCACCACGCGCTATACGACGCATGGAGCATCAAG
ATGATCCAGAGGGACTTGGACAAGCTCCTGGCCTCGGGCAAGGTGCTGCGCCCGCGCGAGCCTCTACAGGACGTG
GTCCGTCAAATCAGGGACATGCGACAGCTCGACGCCGAGGAGTCATACTGGAAGCACCACCTGTCACATGCTCAA
GACACCGTCCTGCACGATGCATCGACAGCGTCCTCGAGCGCGTCCCCGCTGGGCCCGCACTTCAAAGCCAGCCAT
CCGGCCCTCGTGCCGCAGAAGACGGCCGACGCGCTCGGCGGCAGCGCCCGCGTCTCGGCCGCCATCATCCTCGCC
TACGCGCGGGCGCTGGGCCGCCTCACGAAGCGCGCCCGGCCGACCTTCGGGCTGAACCACGCGTCACGCTCGCTC
GAGTCCGCCGACGGCGCGCGGACGCTCGACCTCACGGCCGCCAGCGTCCCGACCTTGACCGTCACACCCTTCTGC
CTCGACCTCGGCGCCTCGTCGTCGTCGTCCGAGGAGCAGTGGCTGGGCCGGGTGCAGGACCAGCTGGCGCAGCTG
GCCCGGTTCGCACAGGCGGACAGCGCGCAGCGCCTCGGCCCCCGCTTCAACTCGTACCTCAACATCCTCCATCGC
GGAGCCGAGGCCGACGACGACGCGACCTTCACGGCGCTCCGCAGGCACAGACTCGGCGAGCCGCTCGCTTCGGCG
TACTTCACCGCCGCCGCGCCGTCGTCCGCGCCGTCCACGATCGAGCAGCTCGAGACTTCGCACCTGTGTCCGCAC
CGGCTCTTCTTCAACGTTGTCGTCCATCAGGGGCAGGGCATCGGCGCGACGGTGGGCGGTGATGTCGAGCTATCT
GGCGTGGCTGCGGAGCTTGTCTCGCGTTTCCGGGAGGAGCTGGTCAGGGTGGTCGAGGGCAGCGTGTGCGGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail