Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9709
Gene name
LocationContig_726:1599..3079
Strand-
Gene length (bp)1480
Transcript length (bp)1179
Coding sequence length (bp)1179
Protein length (aa) 393

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12220 U1snRNP70_N U1 small nuclear ribonucleoprotein of 70kDa MW N terminal 1.7E-26 3 93
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 7.7E-16 106 182

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13829|RU17_SCHPO U1 small nuclear ribonucleoprotein 70 kDa homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=usp101 PE=1 SV=1 1 225 1.0E-41
sp|Q42404|RU17_ARATH U1 small nuclear ribonucleoprotein 70 kDa OS=Arabidopsis thaliana GN=RNU1 PE=1 SV=1 5 204 7.0E-36
sp|P08621|RU17_HUMAN U1 small nuclear ribonucleoprotein 70 kDa OS=Homo sapiens GN=SNRNP70 PE=1 SV=2 1 198 1.0E-33
sp|Q62376|RU17_MOUSE U1 small nuclear ribonucleoprotein 70 kDa OS=Mus musculus GN=Snrnp70 PE=1 SV=2 1 198 2.0E-33
sp|Q1RMR2|RU17_BOVIN U1 small nuclear ribonucleoprotein 70 kDa OS=Bos taurus GN=SNRNP70 PE=2 SV=1 1 198 3.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13829|RU17_SCHPO U1 small nuclear ribonucleoprotein 70 kDa homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=usp101 PE=1 SV=1 1 225 1.0E-41
sp|Q42404|RU17_ARATH U1 small nuclear ribonucleoprotein 70 kDa OS=Arabidopsis thaliana GN=RNU1 PE=1 SV=1 5 204 7.0E-36
sp|P08621|RU17_HUMAN U1 small nuclear ribonucleoprotein 70 kDa OS=Homo sapiens GN=SNRNP70 PE=1 SV=2 1 198 1.0E-33
sp|Q62376|RU17_MOUSE U1 small nuclear ribonucleoprotein 70 kDa OS=Mus musculus GN=Snrnp70 PE=1 SV=2 1 198 2.0E-33
sp|Q1RMR2|RU17_BOVIN U1 small nuclear ribonucleoprotein 70 kDa OS=Bos taurus GN=SNRNP70 PE=2 SV=1 1 198 3.0E-33
sp|Q66II8|RU17_XENTR U1 small nuclear ribonucleoprotein 70 kDa OS=Xenopus tropicalis GN=snrnp70 PE=2 SV=1 1 198 4.0E-32
sp|P09406|RU17_XENLA U1 small nuclear ribonucleoprotein 70 kDa OS=Xenopus laevis GN=snrnp70 PE=2 SV=1 1 198 1.0E-31
sp|P17133|RU17_DROME U1 small nuclear ribonucleoprotein 70 kDa OS=Drosophila melanogaster GN=snRNP-U1-70K PE=1 SV=2 1 196 3.0E-29
sp|Q55FQ0|RU17_DICDI U1 small nuclear ribonucleoprotein 70 kDa OS=Dictyostelium discoideum GN=snrnp70 PE=3 SV=1 81 205 3.0E-24
sp|Q00916|RU17_YEAST U1 small nuclear ribonucleoprotein 70 kDa homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNP1 PE=1 SV=1 3 196 1.0E-23
sp|Q1LZH0|U1SBP_BOVIN U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Bos taurus GN=SNRNP35 PE=2 SV=1 94 198 4.0E-09
sp|Q9D384|U1SBP_MOUSE U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Mus musculus GN=Snrnp35 PE=2 SV=1 94 198 7.0E-09
sp|Q5U1W5|U1SBP_RAT U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Rattus norvegicus GN=Snrnp35 PE=2 SV=1 94 198 1.0E-08
sp|Q16560|U1SBP_HUMAN U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Homo sapiens GN=SNRNP35 PE=1 SV=1 94 198 3.0E-08
sp|W8E7I1|RBM3_CAPHI RNA-binding protein 3 OS=Capra hircus GN=RBM3 PE=2 SV=2 104 184 1.0E-07
sp|P98179|RBM3_HUMAN RNA-binding protein 3 OS=Homo sapiens GN=RBM3 PE=1 SV=1 104 184 2.0E-07
sp|Q925G0|RBM3_RAT RNA-binding protein 3 OS=Rattus norvegicus GN=Rbm3 PE=1 SV=2 104 210 3.0E-07
sp|Q4KMD3|U1SBP_DANRE U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Danio rerio GN=snrnp35 PE=2 SV=1 94 199 4.0E-07
sp|Q29RT0|RBMX_BOVIN RNA-binding motif protein, X chromosome OS=Bos taurus GN=RBMX PE=2 SV=1 104 183 5.0E-07
sp|O89086|RBM3_MOUSE RNA-binding protein 3 OS=Mus musculus GN=Rbm3 PE=1 SV=1 104 184 7.0E-07
sp|O02008|TRA2_DROVI Transformer-2 sex-determining protein OS=Drosophila virilis GN=tra2 PE=3 SV=1 99 221 1.0E-06
sp|O75526|RMXL2_HUMAN RNA-binding motif protein, X-linked-like-2 OS=Homo sapiens GN=RBMXL2 PE=1 SV=3 104 183 2.0E-06
sp|Q5RF83|CIRBP_PONAB Cold-inducible RNA-binding protein OS=Pongo abelii GN=CIRBP PE=2 SV=1 104 184 3.0E-06
sp|Q14011|CIRBP_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens GN=CIRBP PE=1 SV=1 104 184 3.0E-06
sp|Q8VY74|U1135_ARATH U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Arabidopsis thaliana GN=SNRNP35 PE=1 SV=1 78 196 3.0E-06
sp|Q28IQ9|CIRBP_XENTR Cold-inducible RNA-binding protein OS=Xenopus tropicalis GN=cirbp PE=2 SV=1 104 184 5.0E-06
sp|P60825|CIRBP_RAT Cold-inducible RNA-binding protein OS=Rattus norvegicus GN=Cirbp PE=2 SV=1 104 184 5.0E-06
sp|P60824|CIRBP_MOUSE Cold-inducible RNA-binding protein OS=Mus musculus GN=Cirbp PE=1 SV=1 104 184 5.0E-06
sp|P60826|CIRBP_CRIGR Cold-inducible RNA-binding protein OS=Cricetulus griseus GN=CIRBP PE=2 SV=1 104 184 5.0E-06
sp|Q4R813|RMXL2_MACFA RNA-binding motif protein, X-linked-like-2 OS=Macaca fascicularis GN=RBMXL2 PE=2 SV=1 104 183 5.0E-06
sp|P19018|TRA2_DROME Transformer-2 sex-determining protein OS=Drosophila melanogaster GN=tra2 PE=1 SV=1 100 186 6.0E-06
sp|P0C8Z4|RMXL3_PANTR RNA-binding motif protein, X-linked-like-3 OS=Pan troglodytes GN=RBMXL3 PE=3 SV=1 96 183 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9709
MTDKLPPNLLALFAPRPPLRWVEPTDHAPEKRRTKPVSGVGAYLGELQKYKETDTHTPTESWLEARDRKKEEKQT
AIKKLLEEGPKKFQPAEDPNIRGDALRTMIVARLSYEADERDLERHFHRFGPVERIRIVSDTHEHEKPNKKKKPH
RGYAFVVFERESDMQAAVRGCDGDRIKGRAIKTDVERGRTVVGWKPRRLGGGLGGRGYTRIIPSRPVGPRGFGDG
FRGGYRGFDGGRPRGGRGGGRGGGFRGDFGGPRGDRGFGPPSGAPSGPGFDRRNGDRGFSGPGHDSRGHGRYDDR
HGGYRDGGRFGDRDGGRRTGSNMEPIGRRDGGFRDRDRDRDRDRDRDRDRDRDRDRDRGRDRRDYDRPRDDDSRK
RAYEGGGYDDSRKMPRY*
Coding >Hirsu2|9709
ATGACGGACAAGCTTCCTCCGAACCTGCTCGCGCTCTTCGCGCCGCGGCCTCCCCTCCGCTGGGTCGAGCCCACC
GACCACGCGCCCGAGAAGCGGCGAACCAAGCCCGTGAGCGGGGTCGGCGCCTACCTCGGAGAGCTGCAGAAGTAC
AAGGAGACGGACACGCACACTCCGACCGAGAGCTGGCTGGAGGCGCGCGACCGGAAGAAGGAAGAGAAGCAGACG
GCCATCAAGAAGCTCCTCGAGGAGGGCCCCAAGAAGTTTCAACCGGCCGAGGATCCCAACATTCGAGGCGATGCG
CTCAGGACCATGATCGTGGCCCGCCTGAGCTATGAGGCCGACGAACGTGACTTGGAGCGACATTTCCACCGTTTC
GGCCCGGTCGAGCGCATCCGCATCGTGTCAGATACCCATGAACACGAGAAACCCAACAAGAAGAAGAAGCCTCAC
AGAGGTTACGCTTTCGTCGTGTTCGAGCGGGAGTCAGACATGCAAGCCGCTGTCAGAGGTTGTGACGGGGATCGA
ATCAAAGGCAGAGCTATCAAGACAGACGTCGAACGGGGCCGCACCGTCGTCGGCTGGAAGCCCCGAAGACTCGGT
GGCGGACTCGGCGGCCGAGGCTACACCAGAATCATCCCGTCGCGACCCGTCGGGCCCCGTGGCTTCGGCGACGGC
TTCAGGGGGGGTTACCGAGGATTCGATGGTGGACGCCCTCGCGGCGGCCGAGGCGGCGGCCGGGGCGGAGGCTTC
AGGGGTGATTTCGGCGGCCCTCGAGGCGACAGAGGCTTCGGACCGCCCAGCGGCGCGCCCTCCGGGCCAGGCTTC
GACAGGCGAAACGGCGACCGTGGCTTCTCTGGTCCTGGCCACGATTCCCGAGGACACGGTCGTTACGACGACAGA
CACGGTGGCTACCGCGATGGCGGTCGGTTCGGCGATCGTGACGGTGGGCGCCGGACAGGAAGCAACATGGAGCCG
ATTGGCCGCCGAGACGGTGGGTTTCGCGACCGCGACCGTGACCGCGACCGTGACCGCGACCGCGACCGCGACCGC
GATCGCGACAGGGACAGGGACAGGGGACGGGATCGACGGGACTACGATCGGCCGCGTGATGACGACAGCCGGAAG
CGAGCGTACGAGGGAGGCGGCTACGACGATTCACGGAAAATGCCCCGTTACTAA
Transcript >Hirsu2|9709
ATGACGGACAAGCTTCCTCCGAACCTGCTCGCGCTCTTCGCGCCGCGGCCTCCCCTCCGCTGGGTCGAGCCCACC
GACCACGCGCCCGAGAAGCGGCGAACCAAGCCCGTGAGCGGGGTCGGCGCCTACCTCGGAGAGCTGCAGAAGTAC
AAGGAGACGGACACGCACACTCCGACCGAGAGCTGGCTGGAGGCGCGCGACCGGAAGAAGGAAGAGAAGCAGACG
GCCATCAAGAAGCTCCTCGAGGAGGGCCCCAAGAAGTTTCAACCGGCCGAGGATCCCAACATTCGAGGCGATGCG
CTCAGGACCATGATCGTGGCCCGCCTGAGCTATGAGGCCGACGAACGTGACTTGGAGCGACATTTCCACCGTTTC
GGCCCGGTCGAGCGCATCCGCATCGTGTCAGATACCCATGAACACGAGAAACCCAACAAGAAGAAGAAGCCTCAC
AGAGGTTACGCTTTCGTCGTGTTCGAGCGGGAGTCAGACATGCAAGCCGCTGTCAGAGGTTGTGACGGGGATCGA
ATCAAAGGCAGAGCTATCAAGACAGACGTCGAACGGGGCCGCACCGTCGTCGGCTGGAAGCCCCGAAGACTCGGT
GGCGGACTCGGCGGCCGAGGCTACACCAGAATCATCCCGTCGCGACCCGTCGGGCCCCGTGGCTTCGGCGACGGC
TTCAGGGGGGGTTACCGAGGATTCGATGGTGGACGCCCTCGCGGCGGCCGAGGCGGCGGCCGGGGCGGAGGCTTC
AGGGGTGATTTCGGCGGCCCTCGAGGCGACAGAGGCTTCGGACCGCCCAGCGGCGCGCCCTCCGGGCCAGGCTTC
GACAGGCGAAACGGCGACCGTGGCTTCTCTGGTCCTGGCCACGATTCCCGAGGACACGGTCGTTACGACGACAGA
CACGGTGGCTACCGCGATGGCGGTCGGTTCGGCGATCGTGACGGTGGGCGCCGGACAGGAAGCAACATGGAGCCG
ATTGGCCGCCGAGACGGTGGGTTTCGCGACCGCGACCGTGACCGCGACCGTGACCGCGACCGCGACCGCGACCGC
GATCGCGACAGGGACAGGGACAGGGGACGGGATCGACGGGACTACGATCGGCCGCGTGATGACGACAGCCGGAAG
CGAGCGTACGAGGGAGGCGGCTACGACGATTCACGGAAAATGCCCCGTTACTAA
Gene >Hirsu2|9709
ATGACGGACAAGCTTCCTCCGAACCTGCTCGCGCTCTTCGCGCCGCGGCCTCCCCTCCGCTGGGTCGAGCCCACC
GACCACGCGCCCGAGAAGCGGCGAACCAAGCCCGTGAGCGGGGTCGGCGCCTACCTCGGAGAGCTGCAGAAGTAC
AAGGAGACGGACACGCACACTCCGACCGAGAGCTGGCTGGAGGCGCGCGACCGGAAGAAGGAAGAGAAGCAGACG
GCCATCAAGAAGCTCCTCGAGGAGGGCCCCAAGAAGTGTATGGAAGAGACGCCCTTCGCACGGTCACGCGAGCTG
CGAACTGACTATCGATGCCCAGTTCAACCGGCCGAGGATCCCAACATTCGAGGCGATGCGCTCAGGACCATGATC
GTGGCCCGCCTGAGCTATGAGGCCGACGAACGTGACTTGGAGCGACATTTCCACCGTTTCGGCCCGGTCGAGCGC
GTCGGTCTTCCCGCGTCACGTCCGCCTTCCGGTGCCGCCGGCTGACATTCATACCAGATCCGCATCGTGTCAGAT
ACCCATGAACACGAGAAACCCAACAAGAAGAAGAAGCCTCACAGAGGTTACGCTTTCGTCGTGTTCGAGCGGGAG
TCAGACATGCAAGGTAACTAAGTTTCTCCTCATTGGAATTTTTCGGCGCCGGCTTCGTTGCCTGCCATGACGCAT
ACCCGCCACTTTGTTGTCCAGATTTTGGAGGATGCATGATCAGATGTCCAACATCTTCCAACTTGGCCCATCTCC
TACCAAACACTGCTGACACACGTGCCGGCTGGCACCTCCACAATTAGCCGCTGTCAGAGGTTGTGACGGGGATCG
AATCAAAGGCAGAGCTATCAAGACAGACGTCGAACGGGGCCGCACCGTCGTCGGCTGGAAGCCCCGAAGACTCGG
TGGCGGACTCGGCGGCCGAGGCTACACCAGAATCATCCCGTCGCGACCCGTCGGGCCCCGTGGCTTCGGCGACGG
CTTCAGGGGGGGTTACCGAGGATTCGATGGTGGACGCCCTCGCGGCGGCCGAGGCGGCGGCCGGGGCGGAGGCTT
CAGGGGTGATTTCGGCGGCCCTCGAGGCGACAGAGGCTTCGGACCGCCCAGCGGCGCGCCCTCCGGGCCAGGCTT
CGACAGGCGAAACGGCGACCGTGGCTTCTCTGGTCCTGGCCACGATTCCCGAGGACACGGTCGTTACGACGACAG
ACACGGTGGCTACCGCGATGGCGGTCGGTTCGGCGATCGTGACGGTGGGCGCCGGACAGGAAGCAACATGGAGCC
GATTGGCCGCCGAGACGGTGGGTTTCGCGACCGCGACCGTGACCGCGACCGTGACCGCGACCGCGACCGCGACCG
CGATCGCGACAGGGACAGGGACAGGGGACGGGATCGACGGGACTACGATCGGCCGCGTGATGACGACAGCCGGAA
GCGAGCGTACGAGGGAGGCGGCTACGACGATTCACGGAAAATGCCCCGTTACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail