Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9708
Gene name
LocationContig_726:12..681
Strand+
Gene length (bp)669
Transcript length (bp)591
Coding sequence length (bp)591
Protein length (aa) 197

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17777 RL10P_insert Insertion domain in 60S ribosomal protein L10P 1.7E-19 74 162
PF00466 Ribosomal_L10 Ribosomal protein L10 2.1E-07 1 65

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S302|MRT4_NEUCR Ribosome assembly factor mrt4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mrt4 PE=3 SV=1 1 186 4.0E-82
sp|G0S616|MRT4_CHATD Ribosome assembly factor mrt4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0025680 PE=1 SV=2 1 186 1.0E-75
sp|Q9USZ6|MRT4_SCHPO Ribosome assembly factor mrt4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrt4 PE=3 SV=1 1 194 6.0E-42
sp|P33201|MRT4_YEAST Ribosome assembly factor MRT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRT4 PE=1 SV=1 1 186 3.0E-40
sp|Q6FJ04|MRT4_CANGA Ribosome assembly factor mrt4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MRT4 PE=3 SV=1 1 186 2.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S302|MRT4_NEUCR Ribosome assembly factor mrt4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mrt4 PE=3 SV=1 1 186 4.0E-82
sp|G0S616|MRT4_CHATD Ribosome assembly factor mrt4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0025680 PE=1 SV=2 1 186 1.0E-75
sp|Q9USZ6|MRT4_SCHPO Ribosome assembly factor mrt4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrt4 PE=3 SV=1 1 194 6.0E-42
sp|P33201|MRT4_YEAST Ribosome assembly factor MRT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRT4 PE=1 SV=1 1 186 3.0E-40
sp|Q6FJ04|MRT4_CANGA Ribosome assembly factor mrt4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MRT4 PE=3 SV=1 1 186 2.0E-38
sp|Q75DK9|MRT4_ASHGO Ribosome assembly factor mrt4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MRT4 PE=3 SV=1 1 185 2.0E-37
sp|Q9D0I8|MRT4_MOUSE mRNA turnover protein 4 homolog OS=Mus musculus GN=Mrto4 PE=1 SV=1 1 186 2.0E-33
sp|A4FV84|MRT4_BOVIN mRNA turnover protein 4 homolog OS=Bos taurus GN=MRTO4 PE=2 SV=1 1 185 4.0E-32
sp|Q9UKD2|MRT4_HUMAN mRNA turnover protein 4 homolog OS=Homo sapiens GN=MRTO4 PE=1 SV=2 1 185 9.0E-31
sp|Q86HD3|MRT4_DICDI Ribosome assembly factor mrt4 OS=Dictyostelium discoideum GN=mrt4 PE=3 SV=1 1 176 2.0E-19
[Show less]

GO

GO Term Description Terminal node
GO:0042254 ribosome biogenesis Yes
GO:0005622 intracellular Yes
GO:0044085 cellular component biogenesis No
GO:0005575 cellular_component No
GO:0008150 biological_process No
GO:0044464 cell part No
GO:0022613 ribonucleoprotein complex biogenesis No
GO:0071840 cellular component organization or biogenesis No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9708
LQEVRREFDADGRLFFGKARLMARALGQTPAEAVPPGADRLAPFVPGALGLLLTDRAPSAVRAYFAGLARADFAR
AGTPATRAFAIPPGVIHSTAGEVPAEHDLPLEHTLEPELRRLGVPTRMVKGRVVLGDPDGRGQPYVVCKEGDVLD
SRQTRLLKLFGVCMSEFRVRVVAHWSAATGEVTEVDPSAMEGVDED*
Coding >Hirsu2|9708
CTGCAGGAGGTGCGGCGCGAGTTCGACGCCGACGGCCGCCTCTTCTTCGGCAAGGCCCGGCTCATGGCCCGCGCC
CTGGGCCAGACGCCCGCCGAGGCCGTCCCCCCCGGCGCCGACCGCCTGGCGCCCTTCGTCCCCGGCGCCCTCGGC
CTGCTGCTGACGGACCGCGCGCCATCCGCCGTGCGCGCCTACTTCGCCGGCCTCGCCCGCGCCGACTTCGCCCGC
GCCGGCACCCCCGCCACCCGCGCCTTCGCCATCCCCCCCGGCGTCATCCACAGCACCGCCGGCGAGGTCCCCGCC
GAGCACGACCTGCCCCTCGAGCACACCCTCGAGCCCGAGCTCCGGAGGCTCGGCGTCCCGACCCGCATGGTCAAG
GGCCGCGTCGTCCTCGGCGACCCGGACGGCCGCGGCCAGCCGTACGTCGTCTGCAAGGAAGGCGACGTCCTCGAC
TCGCGGCAAACCAGGCTCCTCAAGCTCTTTGGCGTCTGCATGAGCGAGTTTCGAGTCAGGGTCGTTGCCCACTGG
AGCGCTGCGACTGGTGAGGTCACAGAAGTCGACCCATCCGCCATGGAGGGTGTAGATGAAGATTGA
Transcript >Hirsu2|9708
CTGCAGGAGGTGCGGCGCGAGTTCGACGCCGACGGCCGCCTCTTCTTCGGCAAGGCCCGGCTCATGGCCCGCGCC
CTGGGCCAGACGCCCGCCGAGGCCGTCCCCCCCGGCGCCGACCGCCTGGCGCCCTTCGTCCCCGGCGCCCTCGGC
CTGCTGCTGACGGACCGCGCGCCATCCGCCGTGCGCGCCTACTTCGCCGGCCTCGCCCGCGCCGACTTCGCCCGC
GCCGGCACCCCCGCCACCCGCGCCTTCGCCATCCCCCCCGGCGTCATCCACAGCACCGCCGGCGAGGTCCCCGCC
GAGCACGACCTGCCCCTCGAGCACACCCTCGAGCCCGAGCTCCGGAGGCTCGGCGTCCCGACCCGCATGGTCAAG
GGCCGCGTCGTCCTCGGCGACCCGGACGGCCGCGGCCAGCCGTACGTCGTCTGCAAGGAAGGCGACGTCCTCGAC
TCGCGGCAAACCAGGCTCCTCAAGCTCTTTGGCGTCTGCATGAGCGAGTTTCGAGTCAGGGTCGTTGCCCACTGG
AGCGCTGCGACTGGTGAGGTCACAGAAGTCGACCCATCCGCCATGGAGGGTGTAGATGAAGATTGA
Gene >Hirsu2|9708
CTGCAGGAGGTGCGGCGCGAGTTCGACGCCGACGGCCGCCTCTTCTTCGGCAAGGCCCGGCTCATGGCCCGCGCC
CTGGGCCAGACGCCCGCCGAGGCCGTCCCCCCCGGCGCCGACCGCCTGGCGCCCTTCGTCCCCGGCGCCCTCGGC
CTGCTGCTGACGGACCGCGCGCCATCCGCCGTGCGCGCCTACTTCGCCGGCCTCGCCCGCGCCGACTTCGCCCGC
GCCGGCACCCCCGCCACCCGCGCCTTCGCCATCCCCCCCGGCGTCATCCACAGCACCGCCGGCGAGGTCCCCGCC
GAGCACGACCTGCCCCTCGAGCACACCCTCGAGCCCGAGCTCCGGAGGCTCGGCGTCCCGACCCGCATGGTCAAG
GGCCGCGTCGTCCTCGGCGACCCGGACGGCCGCGGCCAGCCGTACGTCGTCTGCAAGGAAGGCGACGTCCTCGAC
TCGCGGCAAACCAGGCTCCTCAAGCTCTTTGGCGTCTGCATGAGCGAGTTTCGAGTCAGGGTCGTTGCGTAAGCA
GACATCCTGTCTCCCCCCCTCCCCTTCCTTTCCGATAGGTCTAGCTGACAGGCTTTTCCCCCTTTACACAGCCAC
TGGAGCGCTGCGACTGGTGAGGTCACAGAAGTCGACCCATCCGCCATGGAGGGTGTAGATGAAGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail