Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9673
Gene name
LocationContig_719:11395..12816
Strand-
Gene length (bp)1421
Transcript length (bp)1359
Coding sequence length (bp)1359
Protein length (aa) 453

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13813 MBOAT_2 Membrane bound O-acyl transferase family 5.9E-16 283 368

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 45 64 19
3 68 90 22
4 334 355 21
5 365 382 17
6 395 417 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9673
MPARLAAGRLEGLSVALLVAGSLLVPVVWLAVPHARRPWLYRARWPVVALVVALQLHLFRHASIENPGAAYVVGV
MLPCAALTTANLVLWRRPQAEAARAVSRPTPTGRVWVWQTFPADESFAARLCWASDLFVSIRGGGWNWAISSIPR
PRAPAHVKSGGRIDLSSIPLETACGCKRPLTARGFLRERLTKILATYLLLDLVTVWHQKDPYYLRGPDYISSQQL
PEHLRHVPAWCLLLYRETLSLAGIVSAFTLYSSLTDLVSFWLLKHLAPARVGVWQHASLFGSFSCVLDRGLSGWW
GGWWHQILRIAFLAPTRHLSRQGYLANGSRRFKAVALLTAFALSGLVHAAGSIMTAAPTKPWRPLVFFLAQAGGI
IVQRGLSRAAKTAWPRPPRALARAANLVFTAAFMYATGPYILDDLASTGIFGLETLPVSPMRALGFGRPGDHWWR
VK*
Coding >Hirsu2|9673
ATGCCCGCTCGCCTCGCCGCCGGCCGACTGGAGGGACTGTCGGTGGCGCTGCTCGTCGCCGGCTCGCTGCTCGTG
CCCGTCGTCTGGCTCGCCGTCCCCCACGCGCGGCGGCCGTGGCTGTACCGGGCGCGGTGGCCGGTCGTCGCGCTC
GTCGTCGCCCTGCAACTCCACCTCTTCCGCCACGCGTCCATCGAGAACCCGGGCGCGGCCTACGTCGTCGGCGTG
ATGCTGCCCTGCGCCGCCCTCACGACCGCCAACCTCGTCCTCTGGCGCAGGCCGCAGGCCGAGGCCGCCCGGGCG
GTGTCGAGGCCGACGCCGACCGGCCGCGTCTGGGTCTGGCAGACGTTCCCGGCGGACGAGTCGTTTGCCGCCCGT
CTTTGCTGGGCTTCGGACCTGTTCGTCAGTATCCGGGGCGGCGGGTGGAACTGGGCCATATCTTCGATTCCACGG
CCTCGCGCCCCTGCCCACGTCAAGTCTGGCGGGCGCATTGACCTGAGCAGCATTCCGCTGGAGACAGCTTGCGGC
TGCAAGAGGCCCCTCACGGCGCGAGGATTCCTGCGCGAGCGCCTGACCAAGATTCTGGCGACGTACCTCCTCCTG
GACCTGGTGACCGTCTGGCACCAAAAGGACCCCTACTACCTTCGGGGGCCGGACTACATTTCCTCTCAGCAGCTC
CCAGAGCATCTGCGGCACGTCCCCGCCTGGTGCCTACTCCTTTACCGCGAGACGTTGAGTCTGGCGGGGATCGTG
AGCGCCTTCACGCTCTACTCTAGTCTCACCGATCTCGTCTCCTTCTGGCTCCTCAAGCACCTCGCCCCCGCGCGC
GTAGGCGTCTGGCAGCACGCCTCCCTTTTCGGCTCCTTCTCCTGCGTCCTCGACCGAGGCCTTTCTGGCTGGTGG
GGGGGCTGGTGGCACCAGATCTTGCGCATCGCGTTCCTCGCCCCGACGCGCCACCTGTCCCGGCAGGGCTACCTT
GCGAACGGCTCCCGGCGCTTCAAAGCGGTGGCCCTGCTCACGGCCTTCGCCCTGTCCGGGCTGGTCCACGCGGCG
GGGAGCATCATGACGGCGGCTCCGACAAAGCCCTGGCGGCCGCTCGTCTTCTTCCTCGCCCAGGCCGGCGGCATC
ATCGTGCAGCGAGGCCTCTCCAGGGCGGCCAAGACGGCCTGGCCCCGCCCGCCGAGAGCCCTGGCCAGGGCAGCG
AACCTGGTCTTCACGGCGGCCTTTATGTATGCCACTGGGCCCTACATCCTCGACGACCTCGCATCGACTGGAATC
TTTGGGCTGGAGACGCTTCCCGTCTCGCCCATGCGCGCGCTGGGCTTTGGCCGTCCCGGGGACCACTGGTGGCGG
GTGAAGTAG
Transcript >Hirsu2|9673
ATGCCCGCTCGCCTCGCCGCCGGCCGACTGGAGGGACTGTCGGTGGCGCTGCTCGTCGCCGGCTCGCTGCTCGTG
CCCGTCGTCTGGCTCGCCGTCCCCCACGCGCGGCGGCCGTGGCTGTACCGGGCGCGGTGGCCGGTCGTCGCGCTC
GTCGTCGCCCTGCAACTCCACCTCTTCCGCCACGCGTCCATCGAGAACCCGGGCGCGGCCTACGTCGTCGGCGTG
ATGCTGCCCTGCGCCGCCCTCACGACCGCCAACCTCGTCCTCTGGCGCAGGCCGCAGGCCGAGGCCGCCCGGGCG
GTGTCGAGGCCGACGCCGACCGGCCGCGTCTGGGTCTGGCAGACGTTCCCGGCGGACGAGTCGTTTGCCGCCCGT
CTTTGCTGGGCTTCGGACCTGTTCGTCAGTATCCGGGGCGGCGGGTGGAACTGGGCCATATCTTCGATTCCACGG
CCTCGCGCCCCTGCCCACGTCAAGTCTGGCGGGCGCATTGACCTGAGCAGCATTCCGCTGGAGACAGCTTGCGGC
TGCAAGAGGCCCCTCACGGCGCGAGGATTCCTGCGCGAGCGCCTGACCAAGATTCTGGCGACGTACCTCCTCCTG
GACCTGGTGACCGTCTGGCACCAAAAGGACCCCTACTACCTTCGGGGGCCGGACTACATTTCCTCTCAGCAGCTC
CCAGAGCATCTGCGGCACGTCCCCGCCTGGTGCCTACTCCTTTACCGCGAGACGTTGAGTCTGGCGGGGATCGTG
AGCGCCTTCACGCTCTACTCTAGTCTCACCGATCTCGTCTCCTTCTGGCTCCTCAAGCACCTCGCCCCCGCGCGC
GTAGGCGTCTGGCAGCACGCCTCCCTTTTCGGCTCCTTCTCCTGCGTCCTCGACCGAGGCCTTTCTGGCTGGTGG
GGGGGCTGGTGGCACCAGATCTTGCGCATCGCGTTCCTCGCCCCGACGCGCCACCTGTCCCGGCAGGGCTACCTT
GCGAACGGCTCCCGGCGCTTCAAAGCGGTGGCCCTGCTCACGGCCTTCGCCCTGTCCGGGCTGGTCCACGCGGCG
GGGAGCATCATGACGGCGGCTCCGACAAAGCCCTGGCGGCCGCTCGTCTTCTTCCTCGCCCAGGCCGGCGGCATC
ATCGTGCAGCGAGGCCTCTCCAGGGCGGCCAAGACGGCCTGGCCCCGCCCGCCGAGAGCCCTGGCCAGGGCAGCG
AACCTGGTCTTCACGGCGGCCTTTATGTATGCCACTGGGCCCTACATCCTCGACGACCTCGCATCGACTGGAATC
TTTGGGCTGGAGACGCTTCCCGTCTCGCCCATGCGCGCGCTGGGCTTTGGCCGTCCCGGGGACCACTGGTGGCGG
GTGAAGTAG
Gene >Hirsu2|9673
ATGCCCGCTCGCCTCGCCGCCGGCCGACTGGAGGGACTGTCGGTGGCGCTGCTCGTCGCCGGCTCGCTGCTCGTG
CCCGTCGTCTGGCTCGCCGTCCCCCACGCGCGGCGGCCGTGGCTGTACCGGGCGCGGTGGCCGGTCGTCGCGCTC
GTCGTCGCCCTGCAACTCCACCTCTTCCGCCACGCGTCCATCGAGAACCCGGGCGCGGCCTACGTCGTCGGCGTG
ATGCTGCCCTGCGCCGCCCTCACGACCGCCAACCTCGTCCTCTGGCGCAGGCCGCAGGCCGAGGCCGCCCGGGCG
GTGTCGAGGCCGACGCCGACCGGCCGCGTCTGGGTCTGGCAGACGTTCCCGGCGGACGAGTCGTTTGCCGCCCGT
CTTTGCTGGGCTTCGGACCTGTTCGTCAGTATCCGGGGCGGCGGTGAGGCCCAAGCCCTCTTCGCCACTGGCCTG
TTTTCTTTTTTCTGACCGTCCGGCTGATAGGGTGGAACTGGGCCATATCTTCGATTCCACGGCCTCGCGCCCCTG
CCCACGTCAAGTCTGGCGGGCGCATTGACCTGAGCAGCATTCCGCTGGAGACAGCTTGCGGCTGCAAGAGGCCCC
TCACGGCGCGAGGATTCCTGCGCGAGCGCCTGACCAAGATTCTGGCGACGTACCTCCTCCTGGACCTGGTGACCG
TCTGGCACCAAAAGGACCCCTACTACCTTCGGGGGCCGGACTACATTTCCTCTCAGCAGCTCCCAGAGCATCTGC
GGCACGTCCCCGCCTGGTGCCTACTCCTTTACCGCGAGACGTTGAGTCTGGCGGGGATCGTGAGCGCCTTCACGC
TCTACTCTAGTCTCACCGATCTCGTCTCCTTCTGGCTCCTCAAGCACCTCGCCCCCGCGCGCGTAGGCGTCTGGC
AGCACGCCTCCCTTTTCGGCTCCTTCTCCTGCGTCCTCGACCGAGGCCTTTCTGGCTGGTGGGGGGGCTGGTGGC
ACCAGATCTTGCGCATCGCGTTCCTCGCCCCGACGCGCCACCTGTCCCGGCAGGGCTACCTTGCGAACGGCTCCC
GGCGCTTCAAAGCGGTGGCCCTGCTCACGGCCTTCGCCCTGTCCGGGCTGGTCCACGCGGCGGGGAGCATCATGA
CGGCGGCTCCGACAAAGCCCTGGCGGCCGCTCGTCTTCTTCCTCGCCCAGGCCGGCGGCATCATCGTGCAGCGAG
GCCTCTCCAGGGCGGCCAAGACGGCCTGGCCCCGCCCGCCGAGAGCCCTGGCCAGGGCAGCGAACCTGGTCTTCA
CGGCGGCCTTTATGTATGCCACTGGGCCCTACATCCTCGACGACCTCGCATCGACTGGAATCTTTGGGCTGGAGA
CGCTTCCCGTCTCGCCCATGCGCGCGCTGGGCTTTGGCCGTCCCGGGGACCACTGGTGGCGGGTGAAGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail