Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|967
Gene name
LocationContig_12:73466..78364
Strand-
Gene length (bp)4898
Transcript length (bp)4746
Coding sequence length (bp)4746
Protein length (aa) 1582

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00636 Ribonuclease_3 Ribonuclease III domain 1.9E-19 1107 1213
PF00636 Ribonuclease_3 Ribonuclease III domain 5.3E-19 1310 1457
PF14622 Ribonucleas_3_3 Ribonuclease-III-like 7.5E-09 1098 1213
PF14622 Ribonucleas_3_3 Ribonuclease-III-like 7.1E-11 1290 1369
PF03368 Dicer_dimer Dicer dimerisation domain 7.6E-17 669 755
PF00271 Helicase_C Helicase conserved C-terminal domain 2.3E-15 476 591
PF04851 ResIII Type III restriction enzyme, res subunit 2.5E-13 138 306
PF00270 DEAD DEAD/DEAH box helicase 1.2E-11 140 306

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2H0G2|DCL1_CHAGB Dicer-like protein 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DCL1 PE=3 SV=2 68 1580 0.0E+00
sp|Q7S8J7|DCL1_NEUCR Dicer-like protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dcl-1 PE=2 SV=1 46 1580 0.0E+00
sp|A4RKC3|DCL1_MAGO7 Dicer-like protein 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DCL1 PE=3 SV=2 58 1580 0.0E+00
sp|Q2VF19|DCL1_CRYPA Dicer-like protein 1 OS=Cryphonectria parasitica GN=DCL-1 PE=3 SV=1 83 1580 0.0E+00
sp|Q2U6C4|DCL1_ASPOR Dicer-like protein 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dcl1 PE=3 SV=2 51 1580 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2H0G2|DCL1_CHAGB Dicer-like protein 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DCL1 PE=3 SV=2 68 1580 0.0E+00
sp|Q7S8J7|DCL1_NEUCR Dicer-like protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dcl-1 PE=2 SV=1 46 1580 0.0E+00
sp|A4RKC3|DCL1_MAGO7 Dicer-like protein 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DCL1 PE=3 SV=2 58 1580 0.0E+00
sp|Q2VF19|DCL1_CRYPA Dicer-like protein 1 OS=Cryphonectria parasitica GN=DCL-1 PE=3 SV=1 83 1580 0.0E+00
sp|Q2U6C4|DCL1_ASPOR Dicer-like protein 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dcl1 PE=3 SV=2 51 1580 0.0E+00
sp|A2RAF3|DCL1_ASPNC Dicer-like protein 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dcl1 PE=3 SV=2 54 1580 0.0E+00
sp|Q0UI93|DCL1_PHANO Dicer-like protein 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DCL1 PE=3 SV=2 85 1580 0.0E+00
sp|Q1DKI1|DCL1_COCIM Dicer-like protein 1 OS=Coccidioides immitis (strain RS) GN=DCL1 PE=3 SV=3 117 1580 0.0E+00
sp|A1DE13|DCL1_NEOFI Dicer-like protein 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dcl1 PE=3 SV=1 45 1580 0.0E+00
sp|Q4WVE3|DCL1_ASPFU Dicer-like protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dcl1 PE=3 SV=3 38 1580 0.0E+00
sp|A1CBC9|DCL1_ASPCL Dicer-like protein 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dcl1 PE=3 SV=2 83 1580 0.0E+00
sp|Q0CW42|DCL1_ASPTN Dicer-like protein 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dcl1 PE=3 SV=2 82 1580 0.0E+00
sp|Q09884|DCR1_SCHPO Protein Dicer OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dcr1 PE=1 SV=1 138 1580 2.0E-113
sp|Q3EBC8|DCL2_ARATH Endoribonuclease Dicer homolog 2 OS=Arabidopsis thaliana GN=At3g03300 PE=1 SV=2 125 1499 4.0E-92
sp|Q10HL3|DCL2A_ORYSJ Endoribonuclease Dicer homolog 2a OS=Oryza sativa subsp. japonica GN=DCL2A PE=2 SV=1 138 1473 6.0E-82
sp|Q4WA22|DCL2_ASPFU Dicer-like protein 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dcl2 PE=3 SV=2 137 1487 3.0E-69
sp|Q1DW80|DCL2_COCIM Dicer-like protein 2 OS=Coccidioides immitis (strain RS) GN=DCL2 PE=3 SV=3 127 1472 7.0E-64
sp|Q5N870|DCL3A_ORYSJ Endoribonuclease Dicer homolog 3a OS=Oryza sativa subsp. japonica GN=DCL3A PE=2 SV=1 136 875 3.0E-63
sp|P34529|DCR1_CAEEL Endoribonuclease dcr-1 OS=Caenorhabditis elegans GN=dcr-1 PE=1 SV=3 136 1012 4.0E-54
sp|Q7XD96|DCL3B_ORYSJ Endoribonuclease Dicer homolog 3b OS=Oryza sativa subsp. japonica GN=DCL3B PE=3 SV=2 135 752 1.0E-51
sp|P84634|DCL4_ARATH Dicer-like protein 4 OS=Arabidopsis thaliana GN=DCL4 PE=1 SV=2 138 752 2.0E-51
sp|A7LFZ6|DCL4_ORYSJ Endoribonuclease Dicer homolog 4 OS=Oryza sativa subsp. japonica GN=DCL4 PE=2 SV=1 465 1473 3.0E-49
sp|Q2UNX5|DCL2_ASPOR Dicer-like protein 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dcl2 PE=3 SV=1 124 846 6.0E-48
sp|Q8R418|DICER_MOUSE Endoribonuclease Dicer OS=Mus musculus GN=Dicer1 PE=1 SV=3 134 1063 2.0E-47
sp|Q69LX2|DCL2B_ORYSJ Endoribonuclease Dicer homolog 2b OS=Oryza sativa subsp. japonica GN=DCL2B PE=2 SV=2 138 623 1.0E-46
sp|Q2VF18|DCL2_CRYPA Dicer-like protein 2 OS=Cryphonectria parasitica GN=DCL-2 PE=3 SV=1 138 765 2.0E-46
sp|A0MQH0|DICER_CRIGR Endoribonuclease Dicer OS=Cricetulus griseus GN=DICER1 PE=2 SV=3 134 1063 1.0E-45
sp|Q6TUI4|DICER_BOVIN Endoribonuclease Dicer OS=Bos taurus GN=DICER1 PE=2 SV=3 134 1063 8.0E-45
sp|Q9UPY3|DICER_HUMAN Endoribonuclease Dicer OS=Homo sapiens GN=DICER1 PE=1 SV=3 134 1063 1.0E-43
sp|B3DLA6|DICER_XENTR Endoribonuclease Dicer OS=Xenopus tropicalis GN=dicer1 PE=2 SV=2 134 1063 1.0E-43
sp|A2QX45|DCL22_ASPNC Dicer-like protein 2-2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dcl2-2 PE=3 SV=2 138 753 2.0E-43
sp|Q0UL22|DCL2_PHANO Dicer-like protein 2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DCL2 PE=3 SV=2 138 888 7.0E-43
sp|Q0CEI2|DCL2_ASPTN Dicer-like protein 2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dcl2 PE=3 SV=2 137 762 2.0E-40
sp|A1C9M6|DCL2_ASPCL Dicer-like protein 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dcl2 PE=3 SV=1 138 848 3.0E-39
sp|A1D9Z6|DCL2_NEOFI Dicer-like protein 2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dcl2 PE=3 SV=1 137 876 4.0E-39
sp|A4RHU9|DCL2_MAGO7 Dicer-like protein 2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DCL2 PE=3 SV=3 106 752 2.0E-37
sp|Q9LXW7|DCL3_ARATH Endoribonuclease Dicer homolog 3 OS=Arabidopsis thaliana GN=DCL3 PE=1 SV=2 140 617 1.0E-36
sp|P0C5H7|DCL2_EMENI Dicer-like protein 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dcl2 PE=3 SV=1 138 834 2.0E-33
sp|Q8LMR2|DCL1_ORYSJ Endoribonuclease Dicer homolog 1 OS=Oryza sativa subsp. japonica GN=DCL1 PE=3 SV=1 996 1499 1.0E-31
sp|Q7SCC1|DCL2_NEUCR Dicer-like protein 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dcl-2 PE=2 SV=4 138 682 3.0E-30
sp|Q5N870|DCL3A_ORYSJ Endoribonuclease Dicer homolog 3a OS=Oryza sativa subsp. japonica GN=DCL3A PE=2 SV=1 1037 1485 9.0E-30
sp|Q9SP32|DCL1_ARATH Endoribonuclease Dicer homolog 1 OS=Arabidopsis thaliana GN=DCL1 PE=1 SV=2 138 352 4.0E-29
sp|A1D9Z6|DCL2_NEOFI Dicer-like protein 2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dcl2 PE=3 SV=1 1034 1498 1.0E-28
sp|Q7XD96|DCL3B_ORYSJ Endoribonuclease Dicer homolog 3b OS=Oryza sativa subsp. japonica GN=DCL3B PE=3 SV=2 1047 1473 8.0E-28
sp|A1C9M6|DCL2_ASPCL Dicer-like protein 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dcl2 PE=3 SV=1 1034 1480 1.0E-27
sp|Q6TV19|DICER_DANRE Endoribonuclease Dicer OS=Danio rerio GN=dicer1 PE=2 SV=2 134 401 2.0E-27
sp|Q69LX2|DCL2B_ORYSJ Endoribonuclease Dicer homolog 2b OS=Oryza sativa subsp. japonica GN=DCL2B PE=2 SV=2 995 1473 3.0E-27
sp|Q9LXW7|DCL3_ARATH Endoribonuclease Dicer homolog 3 OS=Arabidopsis thaliana GN=DCL3 PE=1 SV=2 1037 1473 3.0E-27
sp|P84634|DCL4_ARATH Dicer-like protein 4 OS=Arabidopsis thaliana GN=DCL4 PE=1 SV=2 997 1473 6.0E-27
sp|Q9SP32|DCL1_ARATH Endoribonuclease Dicer homolog 1 OS=Arabidopsis thaliana GN=DCL1 PE=1 SV=2 925 1499 6.0E-27
sp|P0C5H7|DCL2_EMENI Dicer-like protein 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dcl2 PE=3 SV=1 1034 1360 1.0E-26
sp|Q2UNX5|DCL2_ASPOR Dicer-like protein 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dcl2 PE=3 SV=1 1030 1472 2.0E-26
sp|Q9UT23|MPH1_SCHPO ATP-dependent DNA helicase fml1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fml1 PE=1 SV=2 133 601 5.0E-26
sp|Q99J87|DHX58_MOUSE Probable ATP-dependent RNA helicase DHX58 OS=Mus musculus GN=Dhx58 PE=1 SV=2 138 612 2.0E-25
sp|A2R345|DCL21_ASPNC Dicer-like protein 2-1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dcl2-1 PE=3 SV=2 137 350 1.0E-24
sp|A2R345|DCL21_ASPNC Dicer-like protein 2-1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dcl2-1 PE=3 SV=2 994 1466 1.0E-24
sp|Q4WKB5|MPH1_ASPFU ATP-dependent DNA helicase mph1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mph1 PE=3 SV=1 134 601 6.0E-24
sp|B0XMV6|MPH1_ASPFC ATP-dependent DNA helicase mph1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=mph1 PE=3 SV=1 134 601 6.0E-24
sp|Q96C10|DHX58_HUMAN Probable ATP-dependent RNA helicase DHX58 OS=Homo sapiens GN=DHX58 PE=1 SV=1 138 612 8.0E-24
sp|Q6TV19|DICER_DANRE Endoribonuclease Dicer OS=Danio rerio GN=dicer1 PE=2 SV=2 489 1071 3.0E-23
sp|Q0CEI2|DCL2_ASPTN Dicer-like protein 2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dcl2 PE=3 SV=2 1034 1473 1.0E-22
sp|Q25BN1|DICER_CHICK Endoribonuclease Dicer OS=Gallus gallus GN=DICER1 PE=2 SV=3 489 1063 2.0E-22
sp|Q2VF18|DCL2_CRYPA Dicer-like protein 2 OS=Cryphonectria parasitica GN=DCL-2 PE=3 SV=1 1030 1469 4.0E-22
sp|Q0UL22|DCL2_PHANO Dicer-like protein 2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DCL2 PE=3 SV=2 1034 1541 7.0E-22
sp|Q25BN1|DICER_CHICK Endoribonuclease Dicer OS=Gallus gallus GN=DICER1 PE=2 SV=3 134 310 1.0E-21
sp|Q8LMR2|DCL1_ORYSJ Endoribonuclease Dicer homolog 1 OS=Oryza sativa subsp. japonica GN=DCL1 PE=3 SV=1 138 334 2.0E-21
sp|A1D4V5|MPH1_NEOFI ATP-dependent DNA helicase mph1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mph1 PE=3 SV=1 54 601 2.0E-21
sp|A4RHU9|DCL2_MAGO7 Dicer-like protein 2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DCL2 PE=3 SV=3 1037 1457 1.0E-20
sp|A7LFZ6|DCL4_ORYSJ Endoribonuclease Dicer homolog 4 OS=Oryza sativa subsp. japonica GN=DCL4 PE=2 SV=1 138 307 3.0E-20
sp|Q9SP32|DCL1_ARATH Endoribonuclease Dicer homolog 1 OS=Arabidopsis thaliana GN=DCL1 PE=1 SV=2 458 740 4.0E-20
sp|Q7SCC1|DCL2_NEUCR Dicer-like protein 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dcl-2 PE=2 SV=4 1105 1457 4.0E-19
sp|Q9VCU9|DCR1_DROME Endoribonuclease Dcr-1 OS=Drosophila melanogaster GN=Dcr-1 PE=1 SV=1 1191 1564 4.0E-19
sp|O95786|DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 OS=Homo sapiens GN=DDX58 PE=1 SV=2 137 623 6.0E-19
sp|Q8LMR2|DCL1_ORYSJ Endoribonuclease Dicer homolog 1 OS=Oryza sativa subsp. japonica GN=DCL1 PE=3 SV=1 458 740 3.0E-18
sp|Q6BRF0|MPH1_DEBHA ATP-dependent DNA helicase MPH1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MPH1 PE=3 SV=2 138 605 8.0E-18
sp|A1CS00|MPH1_ASPCL ATP-dependent DNA helicase mph1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mph1 PE=3 SV=1 54 601 8.0E-18
sp|A0MQH0|DICER_CRIGR Endoribonuclease Dicer OS=Cricetulus griseus GN=DICER1 PE=2 SV=3 1173 1494 2.0E-16
sp|P34529|DCR1_CAEEL Endoribonuclease dcr-1 OS=Caenorhabditis elegans GN=dcr-1 PE=1 SV=3 1193 1494 3.0E-16
sp|Q58900|Y1505_METJA Putative ATP-dependent RNA helicase MJ1505 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1505 PE=3 SV=2 138 601 5.0E-16
sp|Q6TUI4|DICER_BOVIN Endoribonuclease Dicer OS=Bos taurus GN=DICER1 PE=2 SV=3 1173 1494 7.0E-16
sp|Q8R418|DICER_MOUSE Endoribonuclease Dicer OS=Mus musculus GN=Dicer1 PE=1 SV=3 1273 1494 8.0E-16
sp|Q9UPY3|DICER_HUMAN Endoribonuclease Dicer OS=Homo sapiens GN=DICER1 PE=1 SV=3 1273 1494 2.0E-15
sp|B9KGT5|RNC_ANAMF Ribonuclease 3 OS=Anaplasma marginale (strain Florida) GN=rnc PE=3 SV=1 1277 1390 2.0E-15
sp|Q8R5F7|IFIH1_MOUSE Interferon-induced helicase C domain-containing protein 1 OS=Mus musculus GN=Ifih1 PE=1 SV=1 466 605 2.0E-15
sp|Q6TV19|DICER_DANRE Endoribonuclease Dicer OS=Danio rerio GN=dicer1 PE=2 SV=2 1193 1494 3.0E-15
sp|Q9BYX4|IFIH1_HUMAN Interferon-induced helicase C domain-containing protein 1 OS=Homo sapiens GN=IFIH1 PE=1 SV=3 432 604 3.0E-15
sp|Q25BN1|DICER_CHICK Endoribonuclease Dicer OS=Gallus gallus GN=DICER1 PE=2 SV=3 1173 1494 4.0E-15
sp|Q9GLV6|DDX58_PIG Probable ATP-dependent RNA helicase DDX58 OS=Sus scrofa GN=DDX58 PE=2 SV=1 137 334 6.0E-15
sp|Q5P9U8|RNC_ANAMM Ribonuclease 3 OS=Anaplasma marginale (strain St. Maries) GN=rnc PE=3 SV=1 1277 1390 9.0E-15
sp|B3DLA6|DICER_XENTR Endoribonuclease Dicer OS=Xenopus tropicalis GN=dicer1 PE=2 SV=2 1173 1494 1.0E-14
sp|Q6Q899|DDX58_MOUSE Probable ATP-dependent RNA helicase DDX58 OS=Mus musculus GN=Ddx58 PE=1 SV=2 132 334 1.0E-14
sp|Q7M840|RNC_WOLSU Ribonuclease 3 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=rnc PE=3 SV=1 1274 1371 5.0E-14
sp|Q69KJ0|RTL3_ORYSJ Ribonuclease 3-like protein 3 OS=Oryza sativa subsp. japonica GN=Os06g0358800 PE=2 SV=1 1266 1494 3.0E-13
sp|Q2GIW0|RNC_ANAPZ Ribonuclease 3 OS=Anaplasma phagocytophilum (strain HZ) GN=rnc PE=3 SV=1 1273 1390 2.0E-12
sp|A3GH78|MPH1_PICST ATP-dependent DNA helicase MPH1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=MPH1 PE=3 SV=3 138 355 7.0E-12
sp|A2R345|DCL21_ASPNC Dicer-like protein 2-1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dcl2-1 PE=3 SV=2 536 752 9.0E-12
sp|Q72C44|RNC_DESVH Ribonuclease 3 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=rnc PE=3 SV=1 1275 1468 1.0E-11
sp|Q92AK3|RNC_LISIN Ribonuclease 3 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rnc PE=3 SV=1 1271 1476 2.0E-11
sp|Q8Y691|RNC_LISMO Ribonuclease 3 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rnc PE=3 SV=1 1271 1476 2.0E-11
sp|B8DDU8|RNC_LISMH Ribonuclease 3 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=rnc PE=3 SV=1 1271 1476 2.0E-11
sp|A7EFH4|MPH1_SCLS1 ATP-dependent DNA helicase mph1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=mph1 PE=3 SV=1 134 350 3.0E-11
sp|Q71YL2|RNC_LISMF Ribonuclease 3 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rnc PE=3 SV=1 1271 1476 3.0E-11
sp|C1KWA4|RNC_LISMC Ribonuclease 3 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=rnc PE=3 SV=1 1271 1476 3.0E-11
sp|Q0CWI2|MPH1_ASPTN ATP-dependent DNA helicase mph1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mph1 PE=3 SV=2 138 337 5.0E-11
sp|A0AJR0|RNC_LISW6 Ribonuclease 3 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rnc PE=3 SV=1 1271 1476 7.0E-11
sp|Q7UGZ7|RNC_RHOBA Ribonuclease 3 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=rnc PE=3 SV=2 1273 1368 8.0E-11
sp|Q310Z1|RNC_DESAG Ribonuclease 3 OS=Desulfovibrio alaskensis (strain G20) GN=rnc PE=3 SV=1 1284 1458 9.0E-11
sp|Q9Z9C7|RNC_CHLPN Ribonuclease 3 OS=Chlamydia pneumoniae GN=rnc PE=3 SV=1 1275 1396 1.0E-10
sp|A6RIS1|MPH1_BOTFB ATP-dependent DNA helicase MPH1 OS=Botryotinia fuckeliana (strain B05.10) GN=mph1 PE=3 SV=2 138 350 1.0E-10
sp|B4U7T8|RNC_HYDS0 Ribonuclease 3 OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=rnc PE=3 SV=1 1278 1467 1.0E-10
sp|A0RRM7|RNC_CAMFF Ribonuclease 3 OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=rnc PE=3 SV=1 1275 1477 1.0E-10
sp|Q823R4|RNC_CHLCV Ribonuclease 3 OS=Chlamydophila caviae (strain GPIC) GN=rnc PE=3 SV=1 1275 1396 1.0E-10
sp|A6Q1H0|RNC_NITSB Ribonuclease 3 OS=Nitratiruptor sp. (strain SB155-2) GN=rnc PE=3 SV=1 1275 1371 2.0E-10
sp|Q3AC58|RNC_CARHZ Ribonuclease 3 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rnc PE=3 SV=1 1283 1390 2.0E-10
sp|A7TSV4|MPH1_VANPO ATP-dependent DNA helicase MPH1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MPH1 PE=3 SV=1 528 643 3.0E-10
sp|Q6MLR5|RNC_BDEBA Ribonuclease 3 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=rnc PE=3 SV=1 1278 1476 3.0E-10
sp|O84299|RNC_CHLTR Ribonuclease 3 OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=rnc PE=3 SV=1 1275 1396 4.0E-10
sp|Q3KM65|RNC_CHLTA Ribonuclease 3 OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=rnc PE=3 SV=1 1275 1396 4.0E-10
sp|A6QCJ0|RNC_SULNB Ribonuclease 3 OS=Sulfurovum sp. (strain NBC37-1) GN=rnc PE=3 SV=1 1277 1390 6.0E-10
sp|Q75AA7|MPH1_ASHGO ATP-dependent DNA helicase MPH1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MPH1 PE=3 SV=2 528 681 6.0E-10
sp|B2GD42|RNC_LACF3 Ribonuclease 3 OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=rnc PE=3 SV=1 1276 1476 7.0E-10
sp|Q9HE09|MFH2_SCHPO Putative ATP-dependent DNA helicase fml2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fml2 PE=3 SV=1 138 312 9.0E-10
sp|Q608M7|RNC_METCA Ribonuclease 3 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=rnc PE=3 SV=1 1276 1459 9.0E-10
sp|Q2URJ5|MPH1_ASPOR ATP-dependent DNA helicase mph1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mph1 PE=3 SV=2 138 306 9.0E-10
sp|Q1DY43|MPH1_COCIM ATP-dependent DNA helicase MPH1 OS=Coccidioides immitis (strain RS) GN=MPH1 PE=3 SV=1 134 306 9.0E-10
sp|Q6Q899|DDX58_MOUSE Probable ATP-dependent RNA helicase DDX58 OS=Mus musculus GN=Ddx58 PE=1 SV=2 468 601 1.0E-09
sp|B0B7L3|RNC_CHLT2 Ribonuclease 3 OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=rnc PE=3 SV=1 1275 1396 1.0E-09
sp|B2G826|RNC_LACRJ Ribonuclease 3 OS=Lactobacillus reuteri (strain JCM 1112) GN=rnc PE=3 SV=1 1276 1476 1.0E-09
sp|A5VKP2|RNC_LACRD Ribonuclease 3 OS=Lactobacillus reuteri (strain DSM 20016) GN=rnc PE=3 SV=1 1276 1476 1.0E-09
sp|B0VCU0|RNC_ACIBY Ribonuclease 3 OS=Acinetobacter baumannii (strain AYE) GN=rnc PE=3 SV=1 1283 1373 1.0E-09
sp|A3M7P2|RNC_ACIBT Ribonuclease 3 OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=rnc PE=3 SV=2 1283 1373 1.0E-09
sp|B7GYT0|RNC_ACIB3 Ribonuclease 3 OS=Acinetobacter baumannii (strain AB307-0294) GN=rnc PE=3 SV=2 1283 1373 1.0E-09
sp|B0VTM5|RNC_ACIBS Ribonuclease 3 OS=Acinetobacter baumannii (strain SDF) GN=rnc PE=3 SV=1 1283 1373 1.0E-09
sp|Q03VW5|RNC_LEUMM Ribonuclease 3 OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=rnc PE=3 SV=1 1286 1486 1.0E-09
sp|A2Q8R2|MPH1_ASPNC ATP-dependent DNA helicase mph1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mph1 PE=3 SV=2 138 306 1.0E-09
sp|Q9BYX4|IFIH1_HUMAN Interferon-induced helicase C domain-containing protein 1 OS=Homo sapiens GN=IFIH1 PE=1 SV=3 138 306 2.0E-09
sp|Q253V2|RNC_CHLFF Ribonuclease 3 OS=Chlamydophila felis (strain Fe/C-56) GN=rnc PE=3 SV=1 1275 1396 2.0E-09
sp|Q4UKA8|RNC_RICFE Ribonuclease 3 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=rnc PE=3 SV=1 1274 1390 2.0E-09
sp|Q03FX0|RNC_PEDPA Ribonuclease 3 OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=rnc PE=3 SV=1 1273 1509 2.0E-09
sp|Q1RHA2|RNC_RICBR Ribonuclease 3 OS=Rickettsia bellii (strain RML369-C) GN=rnc PE=3 SV=1 1274 1390 3.0E-09
sp|A8GYE2|RNC_RICB8 Ribonuclease 3 OS=Rickettsia bellii (strain OSU 85-389) GN=rnc PE=3 SV=1 1274 1390 3.0E-09
sp|Q5A1A0|MPH1_CANAL ATP-dependent DNA helicase MPH1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MPH1 PE=3 SV=1 138 337 3.0E-09
sp|Q0A8Z1|RNC_ALKEH Ribonuclease 3 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=rnc PE=3 SV=1 1276 1459 3.0E-09
sp|A6RIS1|MPH1_BOTFB ATP-dependent DNA helicase MPH1 OS=Botryotinia fuckeliana (strain B05.10) GN=mph1 PE=3 SV=2 485 626 4.0E-09
sp|Q6AFJ4|RNC_LEIXX Ribonuclease 3 OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=rnc PE=3 SV=1 1289 1368 4.0E-09
sp|Q39T82|RNC_GEOMG Ribonuclease 3 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=rnc PE=3 SV=1 1268 1368 4.0E-09
sp|A7EFH4|MPH1_SCLS1 ATP-dependent DNA helicase mph1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=mph1 PE=3 SV=1 485 626 5.0E-09
sp|Q9PK97|RNC_CHLMU Ribonuclease 3 OS=Chlamydia muridarum (strain MoPn / Nigg) GN=rnc PE=3 SV=1 1284 1396 5.0E-09
sp|A8GM79|RNC_RICAH Ribonuclease 3 OS=Rickettsia akari (strain Hartford) GN=rnc PE=3 SV=1 1283 1390 5.0E-09
sp|Q0CWI2|MPH1_ASPTN ATP-dependent DNA helicase mph1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mph1 PE=3 SV=2 468 601 6.0E-09
sp|Q5GTI3|RNC_WOLTR Ribonuclease 3 OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=rnc PE=3 SV=1 1276 1390 6.0E-09
sp|Q92JB0|RNC_RICCN Ribonuclease 3 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=rnc PE=3 SV=1 1274 1390 6.0E-09
sp|A8GQT8|RNC_RICRS Ribonuclease 3 OS=Rickettsia rickettsii (strain Sheila Smith) GN=rnc PE=2 SV=1 1274 1390 6.0E-09
sp|B0BW84|RNC_RICRO Ribonuclease 3 OS=Rickettsia rickettsii (strain Iowa) GN=rnc PE=3 SV=1 1274 1390 6.0E-09
sp|C4K1R3|RNC_RICPU Ribonuclease 3 OS=Rickettsia peacockii (strain Rustic) GN=rnc PE=3 SV=1 1274 1390 6.0E-09
sp|C3PMF3|RNC_RICAE Ribonuclease 3 OS=Rickettsia africae (strain ESF-5) GN=rnc PE=3 SV=1 1274 1390 6.0E-09
sp|A8F0M2|RNC_RICM5 Ribonuclease 3 OS=Rickettsia massiliae (strain Mtu5) GN=rnc PE=3 SV=1 1284 1390 6.0E-09
sp|Q9VCU9|DCR1_DROME Endoribonuclease Dcr-1 OS=Drosophila melanogaster GN=Dcr-1 PE=1 SV=1 489 601 7.0E-09
sp|Q04GL2|RNC_OENOB Ribonuclease 3 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=rnc PE=3 SV=1 1278 1476 7.0E-09
sp|Q6ANV0|RNC_DESPS Ribonuclease 3 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=rnc PE=3 SV=1 1284 1480 7.0E-09
sp|A2QX45|DCL22_ASPNC Dicer-like protein 2-2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dcl2-2 PE=3 SV=2 1008 1456 8.0E-09
sp|Q8BGE5|FANCM_MOUSE Fanconi anemia group M protein homolog OS=Mus musculus GN=Fancm PE=1 SV=3 138 336 8.0E-09
sp|Q7SDF3|MPH1_NEUCR ATP-dependent DNA helicase mph1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mph1 PE=3 SV=1 138 337 8.0E-09
sp|A2Q8R2|MPH1_ASPNC ATP-dependent DNA helicase mph1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mph1 PE=3 SV=2 487 601 1.0E-08
sp|Q5L6E3|RNC_CHLAB Ribonuclease 3 OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=rnc PE=3 SV=1 1275 1396 1.0E-08
sp|B0BBS8|RNC_CHLTB Ribonuclease 3 OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=rnc PE=3 SV=1 1275 1396 1.0E-08
sp|Q2GFE4|RNC_EHRCR Ribonuclease 3 OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=rnc PE=3 SV=1 1275 1390 2.0E-08
sp|A1US36|RNC_BARBK Ribonuclease 3 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=rnc PE=3 SV=1 1275 1362 2.0E-08
sp|A4RN08|MPH1_MAGO7 ATP-dependent DNA helicase MPH1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MPH1 PE=3 SV=1 485 601 2.0E-08
sp|Q3YQX7|RNC_EHRCJ Ribonuclease 3 OS=Ehrlichia canis (strain Jake) GN=rnc PE=3 SV=1 1275 1390 2.0E-08
sp|P40562|MPH1_YEAST ATP-dependent DNA helicase MPH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPH1 PE=1 SV=1 528 641 2.0E-08
sp|A6ZVS0|MPH1_YEAS7 ATP-dependent DNA helicase MPH1 OS=Saccharomyces cerevisiae (strain YJM789) GN=MPH1 PE=3 SV=1 528 641 2.0E-08
sp|Q8IYD8|FANCM_HUMAN Fanconi anemia group M protein OS=Homo sapiens GN=FANCM PE=1 SV=2 138 336 2.0E-08
sp|Q8IYD8|FANCM_HUMAN Fanconi anemia group M protein OS=Homo sapiens GN=FANCM PE=1 SV=2 482 670 2.0E-08
sp|Q83FY2|RNC_TROWT Ribonuclease 3 OS=Tropheryma whipplei (strain Twist) GN=rnc PE=3 SV=1 1289 1459 2.0E-08
sp|Q83I82|RNC_TROW8 Ribonuclease 3 OS=Tropheryma whipplei (strain TW08/27) GN=rnc PE=3 SV=2 1289 1459 2.0E-08
sp|Q6F9C2|RNC_ACIAD Ribonuclease 3 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rnc PE=3 SV=1 1283 1373 2.0E-08
sp|Q47S78|RNC_THEFY Ribonuclease 3 OS=Thermobifida fusca (strain YX) GN=rnc PE=3 SV=1 1273 1467 2.0E-08
sp|F0KKL2|RNC_ACICP Ribonuclease 3 OS=Acinetobacter calcoaceticus (strain PHEA-2) GN=rnc PE=3 SV=2 1282 1373 2.0E-08
sp|Q9GLV6|DDX58_PIG Probable ATP-dependent RNA helicase DDX58 OS=Sus scrofa GN=DDX58 PE=2 SV=1 437 601 3.0E-08
sp|Q75AA7|MPH1_ASHGO ATP-dependent DNA helicase MPH1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MPH1 PE=3 SV=2 138 350 3.0E-08
sp|A8EXI3|RNC_RICCK Ribonuclease 3 OS=Rickettsia canadensis (strain McKiel) GN=rnc PE=3 SV=1 1273 1390 3.0E-08
sp|C1DQS2|RNC_AZOVD Ribonuclease 3 OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=rnc PE=3 SV=1 1273 1459 3.0E-08
sp|A8EV88|RNC_ARCB4 Ribonuclease 3 OS=Arcobacter butzleri (strain RM4018) GN=rnc PE=3 SV=1 1284 1371 3.0E-08
sp|Q8R5F7|IFIH1_MOUSE Interferon-induced helicase C domain-containing protein 1 OS=Mus musculus GN=Ifih1 PE=1 SV=1 138 306 4.0E-08
sp|Q9ZE31|RNC_RICPR Ribonuclease 3 OS=Rickettsia prowazekii (strain Madrid E) GN=rnc PE=3 SV=1 1274 1390 4.0E-08
sp|Q2URJ5|MPH1_ASPOR ATP-dependent DNA helicase mph1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mph1 PE=3 SV=2 478 601 6.0E-08
sp|Q3J8D5|RNC_NITOC Ribonuclease 3 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=rnc PE=3 SV=1 1274 1373 6.0E-08
sp|A0L633|RNC_MAGMM Ribonuclease 3 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=rnc PE=3 SV=1 1273 1468 7.0E-08
sp|Q1I5V8|RNC_PSEE4 Ribonuclease 3 OS=Pseudomonas entomophila (strain L48) GN=rnc PE=3 SV=1 1273 1373 7.0E-08
sp|Q6FPQ3|MPH1_CANGA ATP-dependent DNA helicase MPH1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MPH1 PE=3 SV=1 528 676 7.0E-08
sp|O67082|RNC_AQUAE Ribonuclease 3 OS=Aquifex aeolicus (strain VF5) GN=rnc PE=1 SV=1 1275 1366 8.0E-08
sp|Q7SDF3|MPH1_NEUCR ATP-dependent DNA helicase mph1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mph1 PE=3 SV=1 487 601 1.0E-07
sp|Q9PM40|RNC_CAMJE Ribonuclease 3 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=rnc PE=1 SV=1 1275 1461 1.0E-07
sp|Q820I0|RNC_NITEU Ribonuclease 3 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=rnc PE=3 SV=1 1283 1483 1.0E-07
sp|P66665|RNC_BRUSU Ribonuclease 3 OS=Brucella suis biovar 1 (strain 1330) GN=rnc PE=3 SV=1 1278 1379 1.0E-07
sp|B0CKY7|RNC_BRUSI Ribonuclease 3 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=rnc PE=3 SV=1 1278 1379 1.0E-07
sp|P66664|RNC_BRUME Ribonuclease 3 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=rnc PE=3 SV=1 1278 1379 1.0E-07
sp|C0RI03|RNC_BRUMB Ribonuclease 3 OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=rnc PE=3 SV=1 1278 1379 1.0E-07
sp|A9MA35|RNC_BRUC2 Ribonuclease 3 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=rnc PE=3 SV=1 1278 1379 1.0E-07
sp|Q57E81|RNC_BRUAB Ribonuclease 3 OS=Brucella abortus biovar 1 (strain 9-941) GN=rnc PE=3 SV=1 1278 1379 1.0E-07
sp|Q2YN02|RNC_BRUA2 Ribonuclease 3 OS=Brucella abortus (strain 2308) GN=rnc PE=3 SV=1 1278 1379 1.0E-07
sp|B2SAD9|RNC_BRUA1 Ribonuclease 3 OS=Brucella abortus (strain S19) GN=rnc PE=3 SV=1 1278 1379 1.0E-07
sp|Q6CQX2|MPH1_KLULA ATP-dependent DNA helicase MPH1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MPH1 PE=3 SV=2 528 623 1.0E-07
sp|Q6AFJ4|RNC_LEIXX Ribonuclease 3 OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=rnc PE=3 SV=1 1068 1211 2.0E-07
sp|B5Z735|RNC_HELPG Ribonuclease 3 OS=Helicobacter pylori (strain G27) GN=rnc PE=3 SV=1 1278 1394 2.0E-07
sp|P56118|RNC_HELPY Ribonuclease 3 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rnc PE=3 SV=2 1278 1394 2.0E-07
sp|B6JLQ0|RNC_HELP2 Ribonuclease 3 OS=Helicobacter pylori (strain P12) GN=rnc PE=3 SV=1 1278 1394 2.0E-07
sp|Q68XY5|RNC_RICTY Ribonuclease 3 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=rnc PE=3 SV=1 1274 1390 2.0E-07
sp|B2UTG4|RNC_HELPS Ribonuclease 3 OS=Helicobacter pylori (strain Shi470) GN=rnc PE=3 SV=1 1278 1394 2.0E-07
sp|Q9PB98|RNC_XYLFA Ribonuclease 3 OS=Xylella fastidiosa (strain 9a5c) GN=rnc PE=3 SV=2 1283 1381 2.0E-07
sp|B0U3D8|RNC_XYLFM Ribonuclease 3 OS=Xylella fastidiosa (strain M12) GN=rnc PE=3 SV=1 1283 1381 2.0E-07
sp|Q87C06|RNC_XYLFT Ribonuclease 3 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rnc PE=3 SV=1 1283 1381 2.0E-07
sp|B2I604|RNC_XYLF2 Ribonuclease 3 OS=Xylella fastidiosa (strain M23) GN=rnc PE=3 SV=1 1283 1381 2.0E-07
sp|Q9HE09|MFH2_SCHPO Putative ATP-dependent DNA helicase fml2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fml2 PE=3 SV=1 469 603 3.0E-07
sp|A7H5Y2|RNC_CAMJD Ribonuclease 3 OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=rnc PE=3 SV=1 1275 1565 3.0E-07
sp|Q9ZLH2|RNC_HELPJ Ribonuclease 3 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=rnc PE=3 SV=1 1278 1394 3.0E-07
sp|Q67PF5|RNC_SYMTH Ribonuclease 3 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=rnc PE=3 SV=1 1279 1366 3.0E-07
sp|A8FNU7|RNC_CAMJ8 Ribonuclease 3 OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=rnc PE=3 SV=1 1275 1461 3.0E-07
sp|P57805|RNC_PASMU Ribonuclease 3 OS=Pasteurella multocida (strain Pm70) GN=rnc PE=3 SV=1 1275 1348 3.0E-07
sp|Q4JUY7|RNC_CORJK Ribonuclease 3 OS=Corynebacterium jeikeium (strain K411) GN=rnc PE=3 SV=1 1290 1374 3.0E-07
sp|Q9VCU9|DCR1_DROME Endoribonuclease Dcr-1 OS=Drosophila melanogaster GN=Dcr-1 PE=1 SV=1 128 355 4.0E-07
sp|Q1DY43|MPH1_COCIM ATP-dependent DNA helicase MPH1 OS=Coccidioides immitis (strain RS) GN=MPH1 PE=3 SV=1 487 601 4.0E-07
sp|Q82ZG1|RNC_ENTFA Ribonuclease 3 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rnc PE=3 SV=1 1277 1348 4.0E-07
sp|A8Z6F6|RNC_CAMC1 Ribonuclease 3 OS=Campylobacter concisus (strain 13826) GN=rnc PE=3 SV=1 1275 1560 4.0E-07
sp|Q5FJJ7|RNC_LACAC Ribonuclease 3 OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=rnc PE=3 SV=1 1286 1366 4.0E-07
sp|Q8KAN7|RNC_CHLTE Ribonuclease 3 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=rnc PE=3 SV=1 1310 1372 5.0E-07
sp|A9IRN0|RNC_BART1 Ribonuclease 3 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=rnc PE=3 SV=1 1275 1335 5.0E-07
sp|Q5H1R2|RNC_XANOR Ribonuclease 3 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rnc PE=3 SV=1 1277 1381 6.0E-07
sp|C0R4Q8|RNC_WOLWR Ribonuclease 3 OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=rnc PE=3 SV=1 1276 1371 6.0E-07
sp|Q73FT3|RNC_WOLPM Ribonuclease 3 OS=Wolbachia pipientis wMel GN=rnc PE=3 SV=1 1276 1371 6.0E-07
sp|Q8EXX3|RNC_LEPIN Ribonuclease 3 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=rnc PE=3 SV=1 1274 1500 6.0E-07
sp|Q75FW5|RNC_LEPIC Ribonuclease 3 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=rnc PE=3 SV=1 1274 1500 6.0E-07
sp|Q74IP8|RNC_LACJO Ribonuclease 3 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=rnc PE=3 SV=1 1283 1362 6.0E-07
sp|A7TSV4|MPH1_VANPO ATP-dependent DNA helicase MPH1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MPH1 PE=3 SV=1 73 349 7.0E-07
sp|Q0VP19|RNC_ALCBS Ribonuclease 3 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rnc PE=3 SV=1 1283 1373 7.0E-07
sp|Q8PB52|RNC_XANCP Ribonuclease 3 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rnc PE=3 SV=1 1277 1381 7.0E-07
sp|Q4USF7|RNC_XANC8 Ribonuclease 3 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rnc PE=3 SV=1 1277 1381 7.0E-07
sp|Q7VIA9|RNC_HELHP Ribonuclease 3 OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=rnc PE=3 SV=1 1283 1371 9.0E-07
sp|Q5HSF8|RNC_CAMJR Ribonuclease 3 OS=Campylobacter jejuni (strain RM1221) GN=rnc PE=3 SV=1 1275 1371 9.0E-07
sp|B3CMS0|RNC_WOLPP Ribonuclease 3 OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=rnc PE=3 SV=1 1276 1371 1.0E-06
sp|Q5YS08|RNC_NOCFA Ribonuclease 3 OS=Nocardia farcinica (strain IFM 10152) GN=rnc PE=3 SV=1 1280 1351 1.0E-06
sp|Q6N6C1|RNC_RHOPA Ribonuclease 3 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=rnc PE=3 SV=1 1278 1348 1.0E-06
sp|Q8BGE5|FANCM_MOUSE Fanconi anemia group M protein homolog OS=Mus musculus GN=Fancm PE=1 SV=3 487 656 2.0E-06
sp|B7GGE9|RNC_ANOFW Ribonuclease 3 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=rnc PE=3 SV=1 1277 1348 2.0E-06
sp|Q6FPQ3|MPH1_CANGA ATP-dependent DNA helicase MPH1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MPH1 PE=3 SV=1 138 337 3.0E-06
sp|Q17XJ6|RNC_HELAH Ribonuclease 3 OS=Helicobacter acinonychis (strain Sheeba) GN=rnc PE=3 SV=1 1278 1394 3.0E-06
sp|B9K9K8|RNC_THENN Ribonuclease 3 OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=rnc PE=3 SV=1 1268 1458 5.0E-06
sp|A8F397|RNC_PSELT Ribonuclease 3 OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=rnc PE=3 SV=1 1280 1368 7.0E-06
sp|Q6G082|RNC_BARQU Ribonuclease 3 OS=Bartonella quintana (strain Toulouse) GN=rnc PE=3 SV=1 1275 1362 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0005524 ATP binding Yes
GO:0003676 nucleic acid binding Yes
GO:0016891 endoribonuclease activity, producing 5'-phosphomonoesters Yes
GO:0004525 ribonuclease III activity Yes
GO:0006396 RNA processing Yes
GO:0003677 DNA binding Yes
GO:0004519 endonuclease activity No
GO:0043170 macromolecule metabolic process No
GO:0016893 endonuclease activity, active with either ribo- or deoxyribonucleic acids and producing 5'-phosphomonoesters No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0016070 RNA metabolic process No
GO:0003674 molecular_function No
GO:0071704 organic substance metabolic process No
GO:0004540 ribonuclease activity No
GO:0046483 heterocycle metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0008152 metabolic process No
GO:0008144 drug binding No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0090304 nucleic acid metabolic process No
GO:0140098 catalytic activity, acting on RNA No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0004521 endoribonuclease activity No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0032296 double-stranded RNA-specific ribonuclease activity No
GO:0032555 purine ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0004518 nuclease activity No
GO:1901360 organic cyclic compound metabolic process No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|967
MQPIVKLPPQQDGRPLPQPRQEPPSVSLRLKSDARDPPTGPEPDGDDGSDDGSDDGSDDGSDSDEGLEKYRLNGD
RDAVRAPSARKRRGDAAFRQWILDSQRSAVGSAASGQLPLIDRLSTAHLIQTNESNHIIASPREYQIELFERAKE
KNLIIVLDTGSGKTLIAALLLRHTLDQELERRAAGGAPRVAFFLVEKVALCFQQYSVLKANLEHPVAKFHGEMAG
IMRTKDFWDRQFAENMVFVCTAQIVLDCLNSGFLQIGQVNLLVFDEAHHTKKNHPYARIIKDHYLREPHNRPRIL
GMTASPVDSQTSDLRAAASELESMLCSEIATVSDEALMQSQSRRHQVEILEYYQRLLPPKDARTPLWNQVKALLP
DDIQYRAHLDSTEDAASSLGAWCADRYWELLLTDAEVKRQSAKAQATTHGLFSDGGVSEADRILEMLLRLQTIVQ
DNAPSKTAPQDGRGFSSKVQVLRQVLEDAFTKRQTQRCIVFVQKRYTALLLADAFRQIGQHVPGMQPAHLVGSQP
LSSSIANMTFRDQVLTLQRFRRGENNCLFSTQVAEEGIDIPECDLIVRFDLYDSAIQYIQSKGRARQARSTYISM
LEDGNMQHLRRLKQAMRDAHSLRRFCASLPADRKIQDAVDPSTSLENERIAQKVYDIAETGARLTFASSLDVLAK
FVASLGTSEAAPPPEYIVTYSYAHKKFIGTVILPETSPIQSKTGFPQRNKQLARCSAAFQTCVELVKKTYINGHL
QPTLCKRLPAMRNARLALSSNKREEYAMRLKPDLWSHLGPVTELFQNVLALDEPAAAGRPTSPLMLLTRRPLPEL
DPFLLYFDNSRISMARLVPSQAPLAVSSDKVQVLASFTLTIFADVFSKEFDAGPEEMPYFLAPIHTCPDTLVDGP
ARVDWELLRELDQFEVPSWRDATDEFLHDKLVVDPWDGSRKFIIHGINPDLKPTDPVPDGVPGPRSRSFRRTKQT
IKDYSNSLWSNSRKKQQWQDNQPVVNAELLSLRRNFLDEYDHEEAQDMRCWLILEPMRVSKLPIGVVSMALIVPV
MIYRLDSALIALEACSLLGLDIQPNLALEALTKDSSNSEEHGQAQIDFQAGMGRNYERLEFLGDTFLKMATTISL
FTLKPNIDEFESHVERMLLVCNKNLFNHAVDRRVQEYVRSKSFDRRAWYPNMRLKKGKRPKSEVSHSLSDKSIAD
VCEALIGAAYVTSNSSGGRAESWDEDGNMDLAVKAVTKMVRSKNHKMVRFSDYYEVFTMPAWQSAPSTAAQWAAV
DQIAEATGYRFRWPNLLRSAFKHPSYPYEAIPNYQRLEFLGDALLDLVVVEHLFRRFPEADPQWLTEHKMVLVSN
HFFGYLCVRIGLHRHLLMTTSSLVGHISDYVSELEQARDAARLGSGQRKRGSQVDDGVGGDGEDEKNDRGSGDGY
GEDEFWLTTSPPPKALSDMLEALVGAMFVDSGYDYGVVRRFFARLMLPCFDNNVEGCDRHVREHPVKALARQLQD
GLGCVDWGLHVSAVPCGLEHGAGALTDDDVVCALIVHGRTVEHATARTGREAKLLVARAAARVLAGADRLEFRAR
TGCDCG*
Coding >Hirsu2|967
ATGCAACCCATCGTCAAACTGCCTCCCCAGCAGGACGGCCGGCCCTTGCCACAGCCTCGACAGGAACCCCCCTCC
GTCTCTCTCCGCCTCAAGTCCGACGCCCGGGACCCGCCCACAGGCCCAGAGCCCGACGGCGACGACGGCAGCGAC
GACGGCAGCGACGACGGCAGCGACGACGGCAGCGACAGCGATGAAGGCCTCGAAAAGTATCGCCTCAACGGCGAC
AGAGACGCCGTCCGGGCGCCCTCCGCCAGGAAACGCCGTGGCGACGCCGCCTTCCGACAATGGATCTTGGATAGC
CAGCGCTCCGCCGTCGGATCCGCTGCCAGCGGCCAGCTGCCGCTCATCGACCGCTTGTCGACAGCTCATCTGATT
CAGACAAATGAGAGCAATCACATCATCGCCTCGCCTCGCGAGTACCAGATTGAGCTCTTCGAGCGAGCCAAGGAG
AAGAACCTCATCATCGTCCTCGACACGGGATCGGGCAAGACGCTCATCGCCGCGCTTCTACTGCGCCATACGCTG
GATCAGGAGCTAGAGAGGCGAGCCGCGGGTGGGGCTCCTCGCGTCGCCTTCTTCCTCGTAGAAAAGGTGGCCCTG
TGTTTCCAGCAGTACAGCGTGCTCAAGGCCAACCTCGAGCACCCCGTCGCCAAGTTTCACGGCGAAATGGCGGGC
ATCATGAGGACCAAGGACTTTTGGGACAGACAGTTCGCCGAAAACATGGTCTTCGTCTGTACCGCCCAGATCGTG
CTCGACTGCCTTAACAGCGGCTTTCTGCAGATCGGCCAGGTCAACCTTCTCGTCTTCGACGAGGCTCACCACACC
AAGAAGAATCACCCTTATGCCAGGATCATAAAGGACCACTACCTTCGCGAGCCCCATAACCGTCCTCGCATCCTT
GGCATGACGGCCTCTCCCGTCGATTCTCAGACCAGCGACCTCCGTGCCGCCGCCTCGGAGCTCGAGAGCATGCTC
TGTAGCGAGATCGCCACCGTGTCCGACGAGGCTCTTATGCAGAGCCAATCTCGCCGCCACCAAGTCGAAATCTTG
GAGTACTATCAAAGACTTCTTCCGCCCAAAGACGCCCGGACGCCTCTATGGAATCAAGTCAAGGCCCTGCTACCC
GATGACATCCAGTATCGCGCCCACCTCGACTCTACCGAGGATGCCGCCTCCAGCCTCGGGGCCTGGTGTGCCGAC
AGGTACTGGGAACTGCTTCTAACCGACGCCGAGGTCAAGAGACAGTCAGCCAAGGCCCAGGCAACCACCCACGGC
CTATTCAGTGACGGCGGGGTCAGCGAAGCCGACAGGATTCTCGAGATGCTGCTTCGACTTCAGACCATCGTCCAG
GACAATGCACCTTCCAAGACGGCACCACAAGATGGCCGAGGCTTCTCTTCCAAGGTCCAAGTACTCCGGCAAGTC
CTCGAGGACGCATTCACCAAAAGGCAGACGCAGCGGTGCATCGTCTTCGTACAGAAGCGATACACGGCTCTGCTG
CTCGCAGATGCCTTCCGTCAGATTGGCCAGCATGTACCCGGCATGCAGCCGGCTCACCTGGTTGGATCTCAGCCA
CTGTCCTCCAGCATCGCCAACATGACCTTCCGCGACCAGGTCTTGACGCTGCAGAGGTTCAGGCGAGGCGAGAAC
AATTGCCTGTTCTCGACACAGGTGGCCGAGGAAGGCATCGACATTCCCGAATGCGACCTGATCGTTCGCTTTGAC
CTGTACGACTCGGCCATCCAGTACATCCAATCCAAGGGGCGTGCTCGTCAGGCCAGGTCAACGTACATCAGCATG
TTGGAGGACGGCAATATGCAGCATTTGCGAAGGCTCAAGCAAGCCATGAGAGATGCCCACTCGCTTAGGCGCTTC
TGCGCGAGCCTGCCCGCTGACAGGAAGATCCAGGACGCAGTAGATCCGAGCACGTCGTTGGAGAACGAGCGTATC
GCCCAGAAGGTCTACGATATTGCGGAGACGGGGGCCCGACTGACCTTCGCGTCGAGCTTGGATGTGCTCGCCAAG
TTCGTAGCGTCCCTCGGCACCAGCGAGGCTGCCCCCCCGCCGGAGTACATCGTTACCTACTCTTACGCCCACAAG
AAGTTCATCGGAACAGTCATATTGCCGGAAACGAGCCCGATTCAATCTAAGACCGGCTTCCCCCAGCGCAACAAG
CAGCTGGCGAGGTGCTCCGCGGCCTTTCAGACCTGCGTAGAGCTCGTCAAGAAGACATACATCAACGGCCACCTG
CAGCCAACGCTCTGCAAGCGATTGCCTGCGATGCGCAATGCCCGCCTGGCGCTGAGCTCGAATAAGCGCGAGGAA
TATGCCATGCGCCTCAAGCCGGATCTGTGGTCCCACCTTGGACCCGTGACGGAACTATTCCAGAACGTCCTCGCC
CTCGACGAACCCGCTGCAGCCGGGCGGCCGACGAGCCCCTTGATGCTCCTCACCCGACGTCCCTTACCCGAGCTC
GATCCTTTCCTTCTCTATTTCGACAACAGCCGCATTTCGATGGCACGGCTCGTGCCGTCTCAAGCACCCCTGGCC
GTTTCGTCCGACAAGGTCCAAGTACTCGCGTCTTTCACATTAACCATATTTGCGGACGTTTTCAGCAAGGAATTC
GACGCTGGACCCGAGGAGATGCCCTACTTCCTTGCACCGATCCACACTTGCCCGGATACTCTTGTTGACGGGCCC
GCCCGTGTTGACTGGGAACTGCTCAGGGAGCTGGATCAGTTTGAGGTGCCAAGCTGGCGCGATGCGACGGATGAG
TTTTTGCACGACAAGTTGGTCGTAGATCCTTGGGATGGATCCCGCAAGTTCATCATTCACGGCATCAATCCAGAT
CTCAAGCCCACTGACCCTGTTCCCGATGGCGTTCCCGGGCCTAGGAGCCGGTCATTCAGACGGACCAAGCAGACT
ATCAAGGACTACAGCAACAGTCTCTGGTCCAACTCGAGGAAGAAGCAACAGTGGCAAGACAACCAGCCGGTCGTC
AACGCAGAGCTCTTGTCCCTCAGACGCAACTTTCTCGACGAATACGATCACGAGGAGGCGCAGGACATGCGATGC
TGGCTGATTCTGGAGCCCATGAGGGTCTCTAAACTGCCGATCGGCGTTGTGTCCATGGCCCTGATAGTTCCAGTC
ATGATATACCGCCTCGACTCGGCGCTGATCGCACTCGAAGCGTGCTCCCTGTTGGGCCTGGATATCCAGCCGAAC
TTAGCGCTCGAGGCACTAACAAAGGACAGCAGCAATTCGGAGGAGCACGGGCAGGCGCAGATCGACTTCCAGGCG
GGCATGGGACGCAACTACGAGCGGCTCGAGTTTCTGGGTGATACCTTTCTCAAGATGGCCACGACCATCTCCCTG
TTTACACTGAAACCCAACATCGACGAGTTTGAGTCCCACGTCGAGCGCATGCTCCTCGTGTGCAACAAGAACCTG
TTCAACCATGCGGTCGACCGCAGAGTTCAGGAGTACGTGCGGTCGAAGTCCTTTGACCGGCGCGCTTGGTACCCC
AACATGCGGCTCAAGAAGGGCAAGAGGCCCAAGTCGGAGGTGTCGCACAGCCTGTCGGACAAGTCCATCGCCGAC
GTTTGCGAGGCACTGATTGGGGCCGCCTACGTGACCAGCAACAGCAGCGGAGGGAGGGCCGAGAGTTGGGACGAA
GACGGCAACATGGACCTGGCGGTCAAGGCCGTTACCAAGATGGTCCGGAGCAAGAACCACAAGATGGTCAGATTT
AGCGACTACTACGAGGTTTTCACGATGCCGGCGTGGCAGTCGGCGCCCTCGACGGCGGCGCAGTGGGCGGCCGTC
GACCAGATCGCCGAGGCGACGGGCTACCGTTTCCGGTGGCCTAACCTACTGCGGAGCGCCTTCAAGCACCCGTCT
TACCCCTACGAGGCCATCCCCAACTACCAGAGGCTCGAGTTTCTGGGCGATGCGCTGCTGGACCTGGTGGTGGTG
GAGCATCTGTTCCGGCGCTTCCCCGAGGCGGATCCGCAGTGGCTGACGGAGCACAAGATGGTGCTCGTGTCGAAC
CACTTCTTCGGCTACCTGTGCGTCCGCATCGGCCTGCACCGGCACCTGCTGATGACGACGTCGAGCCTCGTGGGC
CATATCAGCGACTATGTCTCTGAGCTGGAGCAGGCGCGCGACGCGGCACGTCTGGGCTCCGGGCAGCGCAAACGC
GGCAGCCAAGTCGACGATGGCGTTGGCGGCGATGGCGAAGACGAGAAGAATGATCGTGGCTCCGGCGACGGCTAC
GGCGAAGACGAGTTCTGGCTGACGACGTCGCCGCCACCAAAGGCGCTGTCCGACATGCTCGAGGCGCTCGTGGGC
GCCATGTTCGTCGACTCCGGCTACGACTATGGCGTGGTGCGGCGCTTCTTCGCGCGGCTGATGCTGCCGTGCTTC
GACAACAACGTCGAGGGCTGCGACCGGCACGTCAGGGAGCACCCGGTGAAGGCTCTAGCGCGGCAGCTGCAGGAC
GGGCTTGGCTGCGTCGACTGGGGCCTGCACGTGTCGGCGGTGCCGTGCGGCCTCGAGCACGGCGCGGGCGCGCTG
ACGGACGACGACGTGGTGTGCGCCCTCATAGTGCACGGGCGGACCGTGGAGCACGCCACGGCGCGGACGGGGCGC
GAGGCCAAGCTGCTGGTGGCGCGCGCGGCGGCCCGGGTCCTGGCGGGCGCGGATCGGCTCGAGTTCCGGGCGCGG
ACCGGATGCGACTGCGGGTGA
Transcript >Hirsu2|967
ATGCAACCCATCGTCAAACTGCCTCCCCAGCAGGACGGCCGGCCCTTGCCACAGCCTCGACAGGAACCCCCCTCC
GTCTCTCTCCGCCTCAAGTCCGACGCCCGGGACCCGCCCACAGGCCCAGAGCCCGACGGCGACGACGGCAGCGAC
GACGGCAGCGACGACGGCAGCGACGACGGCAGCGACAGCGATGAAGGCCTCGAAAAGTATCGCCTCAACGGCGAC
AGAGACGCCGTCCGGGCGCCCTCCGCCAGGAAACGCCGTGGCGACGCCGCCTTCCGACAATGGATCTTGGATAGC
CAGCGCTCCGCCGTCGGATCCGCTGCCAGCGGCCAGCTGCCGCTCATCGACCGCTTGTCGACAGCTCATCTGATT
CAGACAAATGAGAGCAATCACATCATCGCCTCGCCTCGCGAGTACCAGATTGAGCTCTTCGAGCGAGCCAAGGAG
AAGAACCTCATCATCGTCCTCGACACGGGATCGGGCAAGACGCTCATCGCCGCGCTTCTACTGCGCCATACGCTG
GATCAGGAGCTAGAGAGGCGAGCCGCGGGTGGGGCTCCTCGCGTCGCCTTCTTCCTCGTAGAAAAGGTGGCCCTG
TGTTTCCAGCAGTACAGCGTGCTCAAGGCCAACCTCGAGCACCCCGTCGCCAAGTTTCACGGCGAAATGGCGGGC
ATCATGAGGACCAAGGACTTTTGGGACAGACAGTTCGCCGAAAACATGGTCTTCGTCTGTACCGCCCAGATCGTG
CTCGACTGCCTTAACAGCGGCTTTCTGCAGATCGGCCAGGTCAACCTTCTCGTCTTCGACGAGGCTCACCACACC
AAGAAGAATCACCCTTATGCCAGGATCATAAAGGACCACTACCTTCGCGAGCCCCATAACCGTCCTCGCATCCTT
GGCATGACGGCCTCTCCCGTCGATTCTCAGACCAGCGACCTCCGTGCCGCCGCCTCGGAGCTCGAGAGCATGCTC
TGTAGCGAGATCGCCACCGTGTCCGACGAGGCTCTTATGCAGAGCCAATCTCGCCGCCACCAAGTCGAAATCTTG
GAGTACTATCAAAGACTTCTTCCGCCCAAAGACGCCCGGACGCCTCTATGGAATCAAGTCAAGGCCCTGCTACCC
GATGACATCCAGTATCGCGCCCACCTCGACTCTACCGAGGATGCCGCCTCCAGCCTCGGGGCCTGGTGTGCCGAC
AGGTACTGGGAACTGCTTCTAACCGACGCCGAGGTCAAGAGACAGTCAGCCAAGGCCCAGGCAACCACCCACGGC
CTATTCAGTGACGGCGGGGTCAGCGAAGCCGACAGGATTCTCGAGATGCTGCTTCGACTTCAGACCATCGTCCAG
GACAATGCACCTTCCAAGACGGCACCACAAGATGGCCGAGGCTTCTCTTCCAAGGTCCAAGTACTCCGGCAAGTC
CTCGAGGACGCATTCACCAAAAGGCAGACGCAGCGGTGCATCGTCTTCGTACAGAAGCGATACACGGCTCTGCTG
CTCGCAGATGCCTTCCGTCAGATTGGCCAGCATGTACCCGGCATGCAGCCGGCTCACCTGGTTGGATCTCAGCCA
CTGTCCTCCAGCATCGCCAACATGACCTTCCGCGACCAGGTCTTGACGCTGCAGAGGTTCAGGCGAGGCGAGAAC
AATTGCCTGTTCTCGACACAGGTGGCCGAGGAAGGCATCGACATTCCCGAATGCGACCTGATCGTTCGCTTTGAC
CTGTACGACTCGGCCATCCAGTACATCCAATCCAAGGGGCGTGCTCGTCAGGCCAGGTCAACGTACATCAGCATG
TTGGAGGACGGCAATATGCAGCATTTGCGAAGGCTCAAGCAAGCCATGAGAGATGCCCACTCGCTTAGGCGCTTC
TGCGCGAGCCTGCCCGCTGACAGGAAGATCCAGGACGCAGTAGATCCGAGCACGTCGTTGGAGAACGAGCGTATC
GCCCAGAAGGTCTACGATATTGCGGAGACGGGGGCCCGACTGACCTTCGCGTCGAGCTTGGATGTGCTCGCCAAG
TTCGTAGCGTCCCTCGGCACCAGCGAGGCTGCCCCCCCGCCGGAGTACATCGTTACCTACTCTTACGCCCACAAG
AAGTTCATCGGAACAGTCATATTGCCGGAAACGAGCCCGATTCAATCTAAGACCGGCTTCCCCCAGCGCAACAAG
CAGCTGGCGAGGTGCTCCGCGGCCTTTCAGACCTGCGTAGAGCTCGTCAAGAAGACATACATCAACGGCCACCTG
CAGCCAACGCTCTGCAAGCGATTGCCTGCGATGCGCAATGCCCGCCTGGCGCTGAGCTCGAATAAGCGCGAGGAA
TATGCCATGCGCCTCAAGCCGGATCTGTGGTCCCACCTTGGACCCGTGACGGAACTATTCCAGAACGTCCTCGCC
CTCGACGAACCCGCTGCAGCCGGGCGGCCGACGAGCCCCTTGATGCTCCTCACCCGACGTCCCTTACCCGAGCTC
GATCCTTTCCTTCTCTATTTCGACAACAGCCGCATTTCGATGGCACGGCTCGTGCCGTCTCAAGCACCCCTGGCC
GTTTCGTCCGACAAGGTCCAAGTACTCGCGTCTTTCACATTAACCATATTTGCGGACGTTTTCAGCAAGGAATTC
GACGCTGGACCCGAGGAGATGCCCTACTTCCTTGCACCGATCCACACTTGCCCGGATACTCTTGTTGACGGGCCC
GCCCGTGTTGACTGGGAACTGCTCAGGGAGCTGGATCAGTTTGAGGTGCCAAGCTGGCGCGATGCGACGGATGAG
TTTTTGCACGACAAGTTGGTCGTAGATCCTTGGGATGGATCCCGCAAGTTCATCATTCACGGCATCAATCCAGAT
CTCAAGCCCACTGACCCTGTTCCCGATGGCGTTCCCGGGCCTAGGAGCCGGTCATTCAGACGGACCAAGCAGACT
ATCAAGGACTACAGCAACAGTCTCTGGTCCAACTCGAGGAAGAAGCAACAGTGGCAAGACAACCAGCCGGTCGTC
AACGCAGAGCTCTTGTCCCTCAGACGCAACTTTCTCGACGAATACGATCACGAGGAGGCGCAGGACATGCGATGC
TGGCTGATTCTGGAGCCCATGAGGGTCTCTAAACTGCCGATCGGCGTTGTGTCCATGGCCCTGATAGTTCCAGTC
ATGATATACCGCCTCGACTCGGCGCTGATCGCACTCGAAGCGTGCTCCCTGTTGGGCCTGGATATCCAGCCGAAC
TTAGCGCTCGAGGCACTAACAAAGGACAGCAGCAATTCGGAGGAGCACGGGCAGGCGCAGATCGACTTCCAGGCG
GGCATGGGACGCAACTACGAGCGGCTCGAGTTTCTGGGTGATACCTTTCTCAAGATGGCCACGACCATCTCCCTG
TTTACACTGAAACCCAACATCGACGAGTTTGAGTCCCACGTCGAGCGCATGCTCCTCGTGTGCAACAAGAACCTG
TTCAACCATGCGGTCGACCGCAGAGTTCAGGAGTACGTGCGGTCGAAGTCCTTTGACCGGCGCGCTTGGTACCCC
AACATGCGGCTCAAGAAGGGCAAGAGGCCCAAGTCGGAGGTGTCGCACAGCCTGTCGGACAAGTCCATCGCCGAC
GTTTGCGAGGCACTGATTGGGGCCGCCTACGTGACCAGCAACAGCAGCGGAGGGAGGGCCGAGAGTTGGGACGAA
GACGGCAACATGGACCTGGCGGTCAAGGCCGTTACCAAGATGGTCCGGAGCAAGAACCACAAGATGGTCAGATTT
AGCGACTACTACGAGGTTTTCACGATGCCGGCGTGGCAGTCGGCGCCCTCGACGGCGGCGCAGTGGGCGGCCGTC
GACCAGATCGCCGAGGCGACGGGCTACCGTTTCCGGTGGCCTAACCTACTGCGGAGCGCCTTCAAGCACCCGTCT
TACCCCTACGAGGCCATCCCCAACTACCAGAGGCTCGAGTTTCTGGGCGATGCGCTGCTGGACCTGGTGGTGGTG
GAGCATCTGTTCCGGCGCTTCCCCGAGGCGGATCCGCAGTGGCTGACGGAGCACAAGATGGTGCTCGTGTCGAAC
CACTTCTTCGGCTACCTGTGCGTCCGCATCGGCCTGCACCGGCACCTGCTGATGACGACGTCGAGCCTCGTGGGC
CATATCAGCGACTATGTCTCTGAGCTGGAGCAGGCGCGCGACGCGGCACGTCTGGGCTCCGGGCAGCGCAAACGC
GGCAGCCAAGTCGACGATGGCGTTGGCGGCGATGGCGAAGACGAGAAGAATGATCGTGGCTCCGGCGACGGCTAC
GGCGAAGACGAGTTCTGGCTGACGACGTCGCCGCCACCAAAGGCGCTGTCCGACATGCTCGAGGCGCTCGTGGGC
GCCATGTTCGTCGACTCCGGCTACGACTATGGCGTGGTGCGGCGCTTCTTCGCGCGGCTGATGCTGCCGTGCTTC
GACAACAACGTCGAGGGCTGCGACCGGCACGTCAGGGAGCACCCGGTGAAGGCTCTAGCGCGGCAGCTGCAGGAC
GGGCTTGGCTGCGTCGACTGGGGCCTGCACGTGTCGGCGGTGCCGTGCGGCCTCGAGCACGGCGCGGGCGCGCTG
ACGGACGACGACGTGGTGTGCGCCCTCATAGTGCACGGGCGGACCGTGGAGCACGCCACGGCGCGGACGGGGCGC
GAGGCCAAGCTGCTGGTGGCGCGCGCGGCGGCCCGGGTCCTGGCGGGCGCGGATCGGCTCGAGTTCCGGGCGCGG
ACCGGATGCGACTGCGGGTGA
Gene >Hirsu2|967
ATGCAACCCATCGTCAAACTGCCTCCCCAGCAGGACGGCCGGCCCTTGCCACAGCCTCGACAGGAACCCCCCTCC
GTCTCTCTCCGCCTCAAGTCCGACGCCCGGGACCCGCCCACAGGCCCAGAGCCCGACGGCGACGACGGCAGCGAC
GACGGCAGCGACGACGGCAGCGACGACGGCAGCGACAGCGATGAAGGCCTCGAAAAGTATCGCCTCAACGGCGAC
AGAGACGCCGTCCGGGCGCCCTCCGCCAGGAAACGCCGTGGCGACGCCGCCTTCCGACAATGGATCTTGGATAGC
CAGCGCTCCGCCGTCGGATCCGCTGCCAGCGGCCAGCTGCCGCTCATCGACCGCTTGTCGACAGCTCATCTGATT
CAGACAAATGAGAGCAATCACATCATCGCCTCGCCTCGCGAGTACCAGATTGAGCTCTTCGAGCGAGCCAAGGAG
AAGAACCTCATCATCGTCCTCGACACGGGTACGTCTCATGAAGGCTTCGTCGTCCCCCCACCCTGTTCCCTTTCC
CCCGTCCCCTTGAGCAACGCGGCCTGACCGGACCTGCAGGATCGGGCAAGACGCTCATCGCCGCGCTTCTACTGC
GCCATACGCTGGATCAGGAGCTAGAGAGGCGAGCCGCGGGTGGGGCTCCTCGCGTCGCCTTCTTCCTCGTAGAAA
AGGTGGCCCTGTGTTTCCAGCAGTACAGCGTGCTCAAGGCCAACCTCGAGCACCCCGTCGCCAAGTTTCACGGCG
AAATGGCGGGCATCATGAGGACCAAGGACTTTTGGGACAGACAGTTCGCCGAAAACATGGTCTTCGTCTGTACCG
CCCAGATCGTGCTCGACTGCCTTAACAGCGGCTTTCTGCAGATCGGCCAGGTCAACCTTCTCGTCTTCGACGAGG
CTCACCACACCAAGAAGAATCACCCTTATGCCAGGATCATAAAGGACCACTACCTTCGCGAGCCCCATAACCGTC
CTCGCATCCTTGGCATGACGGCCTCTCCCGTCGATTCTCAGACCAGCGACCTCCGTGCCGCCGCCTCGGAGCTCG
AGAGCATGCTCTGTAGCGAGATCGCCACCGTGTCCGACGAGGCTCTTATGCAGAGCCAATCTCGCCGCCACCAAG
TCGAAATCTTGGAGTACTATCAAAGACTTCTTCCGCCCAAAGACGCCCGGACGCCTCTATGGAATCAAGTCAAGG
CCCTGCTACCCGATGACATCCAGTATCGCGCCCACCTCGACTCTACCGAGGATGCCGCCTCCAGCCTCGGGGCCT
GGTGTGCCGACAGGTACTGGGAACTGCTTCTAACCGACGCCGAGGTCAAGAGACAGTCAGCCAAGGCCCAGGCAA
CCACCCACGGCCTATTCAGTGACGGCGGGGTCAGCGAAGCCGACAGGATTCTCGAGATGCTGCTTCGACTTCAGA
CCATCGTCCAGGACAATGCACCTTCCAAGACGGCACCACAAGATGGCCGAGGCTTCTCTTCCAAGGTCCAAGTAC
TCCGGCAAGTCCTCGAGGACGCATTCACCAAAAGGCAGACGCAGCGGTGCATCGTCTTCGTACAGAAGCGATACA
CGGCTCTGCTGCTCGCAGATGCCTTCCGTCAGATTGGCCAGCATGTACCCGGCATGCAGCCGGCTCACCTGGTAA
GTTCGACAGCTCCCCCAGCCCCTAACGTTGTCTCTAATCCGTGGCTCCCCCTCGTCTCTCAGGTTGGATCTCAGC
CACTGTCCTCCAGCATCGCCAACATGACCTTCCGCGACCAGGTCTTGACGCTGCAGAGGTTCAGGCGAGGCGAGA
ACAATTGCCTGTTCTCGACACAGGTGGCCGAGGAAGGCATCGACATTCCCGAATGCGACCTGATCGTTCGCTTTG
ACCTGTACGACTCGGCCATCCAGTACATCCAATCCAAGGGGCGTGCTCGTCAGGCCAGGTCAACGTACATCAGCA
TGTTGGAGGACGGCAATATGCAGCATTTGCGAAGGCTCAAGCAAGCCATGAGAGATGCCCACTCGCTTAGGCGCT
TCTGCGCGAGCCTGCCCGCTGACAGGAAGATCCAGGACGCAGTAGATCCGAGCACGTCGTTGGAGAACGAGCGTA
TCGCCCAGAAGGTCTACGATATTGCGGAGACGGGGGCCCGACTGACCTTCGCGTCGAGCTTGGATGTGCTCGCCA
AGTTCGTAGCGTCCCTCGGCACCAGCGAGGCTGCCCCCCCGCCGGAGTACATCGTTACCTACTCTTACGCCCACA
AGAAGTTCATCGGAACAGTCATATTGCCGGAAACGAGCCCGATTCAATCTAAGACCGGCTTCCCCCAGCGCAACA
AGCAGCTGGCGAGGTGCTCCGCGGCCTTTCAGACCTGCGTAGAGCTCGTCAAGAAGACATACATCAACGGCCACC
TGCAGCCAACGCTCTGCAAGCGATTGCCTGCGATGCGCAATGCCCGCCTGGCGCTGAGCTCGAATAAGCGCGAGG
AATATGCCATGCGCCTCAAGCCGGATCTGTGGTCCCACCTTGGACCCGTGACGGAACTATTCCAGAACGTCCTCG
CCCTCGACGAACCCGCTGCAGCCGGGCGGCCGACGAGCCCCTTGATGCTCCTCACCCGACGTCCCTTACCCGAGC
TCGATCCTTTCCTTCTCTATTTCGACAACAGCCGCATTTCGATGGCACGGCTCGTGCCGTCTCAAGCACCCCTGG
CCGTTTCGTCCGACAAGGTCCAAGTACTCGCGTCTTTCACATTAACCATATTTGCGGACGTTTTCAGCAAGGAAT
TCGACGCTGGACCCGAGGAGATGCCCTACTTCCTTGCACCGATCCACACTTGCCCGGATACTCTTGTTGACGGGC
CCGCCCGTGTTGACTGGGAACTGCTCAGGGAGCTGGATCAGTTTGAGGTGCCAAGCTGGCGCGATGCGACGGATG
AGTTTTTGCACGACAAGTTGGTCGTAGATCCTTGGGATGGATCCCGCAAGTTCATCATTCACGGCATCAATCCAG
ATCTCAAGCCCACTGACCCTGTTCCCGATGGCGTTCCCGGGCCTAGGAGCCGGTCATTCAGACGGACCAAGCAGA
CTATCAAGGACTACAGCAACAGTCTCTGGTCCAACTCGAGGAAGAAGCAACAGTGGCAAGACAACCAGCCGGTCG
TCAACGCAGAGCTCTTGTCCCTCAGACGCAACTTTCTCGACGAATACGATCACGAGGAGGCGCAGGACATGCGAT
GCTGGCTGATTCTGGAGCCCATGAGGGTCTCTAAACTGCCGATCGGCGTTGTGTCCATGGCCCTGATAGTTCCAG
TCATGATATACCGCCTCGACTCGGCGCTGATCGCACTCGAAGCGTGCTCCCTGTTGGGCCTGGATATCCAGCCGA
ACTTAGCGCTCGAGGCACTAACAAAGGACAGCAGCAATTCGGAGGAGCACGGGCAGGCGCAGATCGACTTCCAGG
CGGGCATGGGACGCAACTACGAGCGGCTCGAGTTTCTGGGTGATACCTTTCTCAAGATGGCCACGACCATCTCCC
TGTTTACACTGAAACCCAACATCGACGAGTTTGAGTCCCACGTCGAGCGCATGCTCCTCGTGTGCAACAAGAACC
TGTTCAACCATGCGGTCGACCGCAGAGTTCAGGAGTACGTGCGGTCGAAGTCCTTTGACCGGCGCGCTTGGTACC
CCAACATGCGGCTCAAGAAGGGCAAGAGGCCCAAGTCGGAGGTGTCGCACAGCCTGTCGGACAAGTCCATCGCCG
ACGTTTGCGAGGCACTGATTGGGGCCGCCTACGTGACCAGCAACAGCAGCGGAGGGAGGGCCGAGAGTTGGGACG
AAGACGGCAACATGGACCTGGCGGTCAAGGCCGTTACCAAGATGGTCCGGAGCAAGAACCACAAGATGGTCAGAT
TTAGCGACTACTACGAGGTTTTCACGATGCCGGCGTGGCAGTCGGCGCCCTCGACGGCGGCGCAGTGGGCGGCCG
TCGACCAGATCGCCGAGGCGACGGGCTACCGTTTCCGGTGGCCTAACCTACTGCGGAGCGCCTTCAAGCACCCGT
CTTACCCCTACGAGGCCATCCCCAACTACCAGAGGCTCGAGTTTCTGGGCGATGCGCTGCTGGACCTGGTGGTGG
TGGAGCATCTGTTCCGGCGCTTCCCCGAGGCGGATCCGCAGTGGCTGACGGAGCACAAGATGGTGCTCGTGTCGA
ACCACTTCTTCGGCTACCTGTGCGTCCGCATCGGCCTGCACCGGCACCTGCTGATGACGACGTCGAGCCTCGTGG
GCCATATCAGCGACTATGTCTCTGAGCTGGAGCAGGCGCGCGACGCGGCACGTCTGGGCTCCGGGCAGCGCAAAC
GCGGCAGCCAAGTCGACGATGGCGTTGGCGGCGATGGCGAAGACGAGAAGAATGATCGTGGCTCCGGCGACGGCT
ACGGCGAAGACGAGTTCTGGCTGACGACGTCGCCGCCACCAAAGGCGCTGTCCGACATGCTCGAGGCGCTCGTGG
GCGCCATGTTCGTCGACTCCGGCTACGACTATGGCGTGGTGCGGCGCTTCTTCGCGCGGCTGATGCTGCCGTGCT
TCGACAACAACGTCGAGGGCTGCGACCGGCACGTCAGGGAGCACCCGGTGAAGGCTCTAGCGCGGCAGCTGCAGG
ACGGGCTTGGCTGCGTCGACTGGGGCCTGCACGTGTCGGCGGTGCCGTGCGGCCTCGAGCACGGCGCGGGCGCGC
TGACGGACGACGACGTGGTGTGCGCCCTCATAGTGCACGGGCGGACCGTGGAGCACGCCACGGCGCGGACGGGGC
GCGAGGCCAAGCTGCTGGTGGCGCGCGCGGCGGCCCGGGTCCTGGCGGGCGCGGATCGGCTCGAGTTCCGGGCGC
GGACCGGATGCGACTGCGGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail