Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9667
Gene name
LocationContig_718:10561..13484
Strand+
Gene length (bp)2923
Transcript length (bp)2658
Coding sequence length (bp)2658
Protein length (aa) 886

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13718 GNAT_acetyltr_2 GNAT acetyltransferase 2 5.4E-98 537 767
PF05127 Helicase_RecD Helicase 1.1E-63 282 495
PF13725 tRNA_bind_2 Possible tRNA binding domain 4.6E-44 775 881
PF08351 DUF1726 Domain of unknown function (DUF1726) 1.4E-32 108 202

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87115|NAT10_SCHPO RNA cytidine acetyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nat10 PE=1 SV=1 1 881 0.0E+00
sp|Q9H0A0|NAT10_HUMAN RNA cytidine acetyltransferase OS=Homo sapiens GN=NAT10 PE=1 SV=2 1 880 0.0E+00
sp|Q8K224|NAT10_MOUSE RNA cytidine acetyltransferase OS=Mus musculus GN=Nat10 PE=1 SV=1 1 880 0.0E+00
sp|Q55EJ3|NAT10_DICDI RNA cytidine acetyltransferase OS=Dictyostelium discoideum GN=nat10 PE=3 SV=1 1 873 0.0E+00
sp|O01757|NAT10_CAEEL RNA cytidine acetyltransferase OS=Caenorhabditis elegans GN=nath-10 PE=3 SV=1 3 880 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87115|NAT10_SCHPO RNA cytidine acetyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nat10 PE=1 SV=1 1 881 0.0E+00
sp|Q9H0A0|NAT10_HUMAN RNA cytidine acetyltransferase OS=Homo sapiens GN=NAT10 PE=1 SV=2 1 880 0.0E+00
sp|Q8K224|NAT10_MOUSE RNA cytidine acetyltransferase OS=Mus musculus GN=Nat10 PE=1 SV=1 1 880 0.0E+00
sp|Q55EJ3|NAT10_DICDI RNA cytidine acetyltransferase OS=Dictyostelium discoideum GN=nat10 PE=3 SV=1 1 873 0.0E+00
sp|O01757|NAT10_CAEEL RNA cytidine acetyltransferase OS=Caenorhabditis elegans GN=nath-10 PE=3 SV=1 3 880 0.0E+00
sp|Q9XIK4|NT101_ARATH RNA cytidine acetyltransferase 1 OS=Arabidopsis thaliana GN=At1g10490 PE=2 SV=2 3 880 0.0E+00
sp|Q9W3C1|NAT10_DROME RNA cytidine acetyltransferase OS=Drosophila melanogaster GN=l(1)G0020 PE=1 SV=2 1 881 0.0E+00
sp|Q9M2Q4|NT102_ARATH RNA cytidine acetyltransferase 2 OS=Arabidopsis thaliana GN=At3g57940 PE=2 SV=2 3 880 0.0E+00
sp|P53914|NAT10_YEAST RNA cytidine acetyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAT10 PE=1 SV=1 1 880 0.0E+00
sp|P54008|NAT10_ACHAM RNA cytidine acetyltransferase (Fragment) OS=Achlya ambisexualis PE=3 SV=1 463 795 3.0E-108
sp|Q9UZ78|TMCA_PYRAB tRNA(Met) cytidine acetyltransferase TmcA OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=tmcA PE=3 SV=1 59 866 1.0E-67
sp|Q8TYZ5|TMCA_METKA tRNA(Met) cytidine acetyltransferase TmcA OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=tmcA PE=3 SV=1 59 866 8.0E-67
sp|A1RY08|TMCA_THEPD tRNA(Met) cytidine acetyltransferase TmcA OS=Thermofilum pendens (strain Hrk 5) GN=tmcA PE=3 SV=1 4 871 1.0E-59
sp|C3N792|TMCA_SULIY tRNA(Met) cytidine acetyltransferase TmcA OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=tmcA PE=3 SV=1 108 767 3.0E-39
sp|D5C1K8|TMCA_NITHN tRNA(Met) cytidine acetyltransferase TmcA OS=Nitrosococcus halophilus (strain Nc4) GN=tmcA PE=3 SV=1 253 795 6.0E-37
sp|D4GW73|TMCA_HALVD tRNA(Met) cytidine acetyltransferase TmcA OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=tmcA PE=3 SV=1 109 770 4.0E-35
sp|Q5V5M5|TMCA_HALMA tRNA(Met) cytidine acetyltransferase TmcA OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=tmcA PE=3 SV=1 112 792 1.0E-29
sp|Q9KKJ5|TMCA_VIBCH tRNA(Met) cytidine acetyltransferase TmcA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=tmcA PE=3 SV=1 280 666 3.0E-25
sp|Q9YBQ6|TMCA_AERPE tRNA(Met) cytidine acetyltransferase TmcA OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=tmcA PE=3 SV=1 251 637 2.0E-22
sp|A8ADB3|TMCA_CITK8 tRNA(Met) cytidine acetyltransferase TmcA OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=tmcA PE=3 SV=1 278 663 1.0E-17
sp|Q7VLN6|TMCA_HAEDU tRNA(Met) cytidine acetyltransferase TmcA OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=tmcA PE=3 SV=1 383 785 8.0E-15
sp|Q5QY69|TMCA_IDILO tRNA(Met) cytidine acetyltransferase TmcA OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=tmcA PE=3 SV=1 279 639 2.0E-10
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9667
MSRKQLDQRIQTLIRNGLQEKKRSFFVVVGDRSKDVIVYLHHIMSSMDIKQNKSVLWAYKSKLLGFTSHRKKREQ
KIKKEIKRGIREANAEDPFELFVSLHNIRYTYYKETDKILGNTFGMCVLQDFEALTPNILARTIETVEGGGLVIM
LLKGMNSLRQLYNLSMDVHSRYRTEAHKEVVARFNERFLLSLGRCDSCLVIDDELNVLPISGGKDVKALPPPDLD
QPKTPEQMELESVKDEHREQEPVGSLISLAKSVDQAKALLTFTEAIAEKTLRSTVALTAARGRGKSAAMGVAVAA
AVAYGYSNIFITSPSPENLKTLFEFIFKGFDALDYADHADYTIIQSTNPDFNKAIVRVNIHRQHRQTIQYIRPQD
AHVLGQAELVVIDEAAAIPLPLVKKLMGPYLVFMASTINGYEGTGRSLSLKLIKQLREESRSASSRNGDTELADR
STGKAAKVAEYQSARKLREITLAEPIRYTRGDAVEKWLNKLLCLDATLPKSKSNVYGCPDPSQCELLAVNRDTLF
SFHPVSEAFLQQMVALYVASHYKNSPDDLQLMSDAPAHELFVLVPPNVEGSGKLPEPLCVIQVALEGKISRQSVL
NSLSRGQRPHGDLIPWLVSQQFQDEDFASLSGARIVRIATNPEYVSMGYGTKALQLLVDFYEGRFASLSEEDDQR
TEERVERATDAELAKTSLLEEEITVRDQAKMPPLFAKLRERKPEALDYLGVSYGLTGPLHKFWKRSSFSPVYLRQ
TANGLTGEHTCVMLRPLDNSQDRSWLGAFSRDFQKRFLSLLSYQFRTFATKTALGIDESARRGASLDAVETAPLD
KAELDRHLTPFDLKRLESYANNMLDYHVILDMLPTIAALFFGGKLKADVRLTGVQQWCAR*
Coding >Hirsu2|9667
ATGTCGCGAAAACAGCTGGACCAGCGCATCCAGACTCTCATCCGCAATGGCCTGCAGGAGAAGAAGAGGAGCTTC
TTCGTCGTCGTCGGCGATCGATCCAAGGATGTCATCGTGTACTTGCATCACATCATGTCTAGCATGGACATCAAG
CAGAACAAGTCCGTCCTGTGGGCGTATAAGAGCAAGCTGCTTGGATTCACGAGCCATCGGAAGAAGCGCGAGCAG
AAGATCAAGAAGGAGATCAAGCGCGGCATCCGCGAAGCCAACGCCGAGGACCCCTTCGAGCTCTTCGTCTCCCTG
CACAACATCCGATACACGTACTACAAGGAGACGGACAAAATCCTCGGCAACACCTTCGGCATGTGCGTCCTGCAG
GACTTCGAGGCCCTGACGCCCAACATCCTGGCCCGCACCATCGAGACGGTCGAGGGCGGCGGCTTGGTCATCATG
CTGCTCAAGGGCATGAACAGTCTGAGACAGCTGTACAACCTGTCGATGGACGTCCACTCCAGGTACCGCACAGAG
GCGCATAAGGAAGTGGTGGCGAGGTTCAACGAGCGATTCCTGCTGTCTCTCGGCCGTTGTGACTCCTGTCTCGTC
ATCGACGACGAACTCAACGTCCTGCCCATATCCGGTGGCAAAGACGTCAAGGCCCTGCCCCCGCCGGACCTGGAC
CAGCCCAAGACGCCGGAGCAGATGGAGCTGGAAAGCGTCAAGGATGAGCATCGAGAACAGGAACCGGTCGGCTCC
CTCATCTCCCTCGCTAAGTCGGTTGACCAAGCCAAGGCGCTCCTGACCTTCACCGAAGCCATTGCCGAGAAGACG
CTGAGAAGCACCGTCGCTCTGACGGCCGCCAGAGGTCGAGGCAAGTCGGCCGCCATGGGTGTGGCCGTCGCGGCG
GCCGTCGCGTACGGATACAGCAACATCTTCATCACGTCGCCCTCGCCGGAGAACTTGAAGACGCTCTTCGAGTTC
ATCTTCAAGGGCTTCGATGCCTTGGACTATGCCGACCACGCCGACTATACCATCATTCAGAGCACCAACCCCGAC
TTCAACAAGGCCATCGTCCGCGTCAACATCCACAGGCAACACCGTCAGACCATTCAGTACATCCGGCCGCAGGAT
GCGCACGTGCTGGGCCAGGCAGAGCTTGTCGTCATCGACGAGGCCGCCGCCATCCCCTTGCCGCTCGTCAAGAAG
CTCATGGGCCCGTATCTGGTCTTCATGGCCTCCACAATCAACGGCTACGAAGGCACCGGCCGTTCGCTTTCACTC
AAGCTCATCAAACAGCTGCGGGAAGAGTCGCGCTCTGCCTCTTCCAGGAACGGAGACACCGAGCTCGCCGATAGA
TCGACGGGCAAGGCGGCCAAGGTTGCCGAGTACCAGTCGGCTCGGAAGCTGCGAGAAATCACGCTCGCCGAGCCC
ATCCGATATACCCGCGGCGATGCGGTCGAGAAGTGGCTGAACAAGCTTCTATGTCTCGACGCGACGCTGCCCAAG
TCCAAGTCCAACGTCTACGGATGTCCCGACCCGTCCCAGTGCGAGCTCCTGGCCGTCAACCGGGACACACTCTTC
TCCTTCCATCCGGTGTCCGAGGCGTTCCTGCAGCAGATGGTGGCCCTGTACGTTGCTAGCCACTACAAGAACTCA
CCGGACGACCTGCAGCTCATGAGCGACGCGCCGGCGCACGAGCTCTTTGTCCTGGTGCCGCCCAACGTGGAGGGC
AGCGGAAAGCTGCCGGAGCCGCTGTGCGTCATCCAAGTAGCCCTGGAGGGAAAGATCAGCAGACAGAGCGTGCTC
AACAGCCTGAGCCGAGGGCAGCGGCCGCACGGGGATCTGATACCCTGGCTCGTGAGCCAGCAATTCCAGGACGAG
GACTTTGCATCCTTGTCGGGCGCGCGCATCGTGAGGATAGCAACCAACCCGGAATACGTGTCCATGGGCTACGGG
ACAAAGGCACTGCAGCTCCTCGTCGACTTTTATGAGGGCCGCTTCGCCAGTCTGTCGGAAGAGGACGACCAAAGA
ACGGAGGAGAGGGTGGAGCGGGCAACGGACGCAGAGCTGGCCAAGACGTCACTGCTGGAGGAGGAGATCACTGTC
CGAGACCAGGCCAAGATGCCCCCCCTCTTCGCGAAGCTCCGGGAGAGGAAGCCGGAAGCGCTCGACTACCTCGGC
GTCAGCTACGGCCTGACGGGGCCCCTGCACAAGTTCTGGAAGCGGTCCAGTTTCTCGCCCGTCTACCTTCGGCAA
ACGGCCAACGGCCTGACGGGCGAGCACACGTGCGTCATGCTGCGGCCGCTCGACAACAGCCAGGACAGGAGCTGG
CTCGGGGCGTTCTCGCGAGACTTCCAGAAGCGCTTCCTGTCGCTCCTGTCGTACCAGTTTCGCACGTTCGCGACC
AAGACGGCGCTGGGGATCGACGAGTCGGCCCGGCGCGGGGCCAGTCTGGACGCGGTCGAGACGGCGCCGCTGGAC
AAGGCGGAGCTGGACCGGCACCTGACGCCCTTCGACCTGAAGCGGCTGGAGTCGTACGCGAACAACATGCTCGAC
TACCACGTCATCCTCGACATGCTCCCGACGATCGCCGCCCTCTTCTTCGGCGGCAAGCTGAAGGCGGACGTCCGG
CTGACGGGCGTGCAGCAGTGGTGCGCAAGGTGA
Transcript >Hirsu2|9667
ATGTCGCGAAAACAGCTGGACCAGCGCATCCAGACTCTCATCCGCAATGGCCTGCAGGAGAAGAAGAGGAGCTTC
TTCGTCGTCGTCGGCGATCGATCCAAGGATGTCATCGTGTACTTGCATCACATCATGTCTAGCATGGACATCAAG
CAGAACAAGTCCGTCCTGTGGGCGTATAAGAGCAAGCTGCTTGGATTCACGAGCCATCGGAAGAAGCGCGAGCAG
AAGATCAAGAAGGAGATCAAGCGCGGCATCCGCGAAGCCAACGCCGAGGACCCCTTCGAGCTCTTCGTCTCCCTG
CACAACATCCGATACACGTACTACAAGGAGACGGACAAAATCCTCGGCAACACCTTCGGCATGTGCGTCCTGCAG
GACTTCGAGGCCCTGACGCCCAACATCCTGGCCCGCACCATCGAGACGGTCGAGGGCGGCGGCTTGGTCATCATG
CTGCTCAAGGGCATGAACAGTCTGAGACAGCTGTACAACCTGTCGATGGACGTCCACTCCAGGTACCGCACAGAG
GCGCATAAGGAAGTGGTGGCGAGGTTCAACGAGCGATTCCTGCTGTCTCTCGGCCGTTGTGACTCCTGTCTCGTC
ATCGACGACGAACTCAACGTCCTGCCCATATCCGGTGGCAAAGACGTCAAGGCCCTGCCCCCGCCGGACCTGGAC
CAGCCCAAGACGCCGGAGCAGATGGAGCTGGAAAGCGTCAAGGATGAGCATCGAGAACAGGAACCGGTCGGCTCC
CTCATCTCCCTCGCTAAGTCGGTTGACCAAGCCAAGGCGCTCCTGACCTTCACCGAAGCCATTGCCGAGAAGACG
CTGAGAAGCACCGTCGCTCTGACGGCCGCCAGAGGTCGAGGCAAGTCGGCCGCCATGGGTGTGGCCGTCGCGGCG
GCCGTCGCGTACGGATACAGCAACATCTTCATCACGTCGCCCTCGCCGGAGAACTTGAAGACGCTCTTCGAGTTC
ATCTTCAAGGGCTTCGATGCCTTGGACTATGCCGACCACGCCGACTATACCATCATTCAGAGCACCAACCCCGAC
TTCAACAAGGCCATCGTCCGCGTCAACATCCACAGGCAACACCGTCAGACCATTCAGTACATCCGGCCGCAGGAT
GCGCACGTGCTGGGCCAGGCAGAGCTTGTCGTCATCGACGAGGCCGCCGCCATCCCCTTGCCGCTCGTCAAGAAG
CTCATGGGCCCGTATCTGGTCTTCATGGCCTCCACAATCAACGGCTACGAAGGCACCGGCCGTTCGCTTTCACTC
AAGCTCATCAAACAGCTGCGGGAAGAGTCGCGCTCTGCCTCTTCCAGGAACGGAGACACCGAGCTCGCCGATAGA
TCGACGGGCAAGGCGGCCAAGGTTGCCGAGTACCAGTCGGCTCGGAAGCTGCGAGAAATCACGCTCGCCGAGCCC
ATCCGATATACCCGCGGCGATGCGGTCGAGAAGTGGCTGAACAAGCTTCTATGTCTCGACGCGACGCTGCCCAAG
TCCAAGTCCAACGTCTACGGATGTCCCGACCCGTCCCAGTGCGAGCTCCTGGCCGTCAACCGGGACACACTCTTC
TCCTTCCATCCGGTGTCCGAGGCGTTCCTGCAGCAGATGGTGGCCCTGTACGTTGCTAGCCACTACAAGAACTCA
CCGGACGACCTGCAGCTCATGAGCGACGCGCCGGCGCACGAGCTCTTTGTCCTGGTGCCGCCCAACGTGGAGGGC
AGCGGAAAGCTGCCGGAGCCGCTGTGCGTCATCCAAGTAGCCCTGGAGGGAAAGATCAGCAGACAGAGCGTGCTC
AACAGCCTGAGCCGAGGGCAGCGGCCGCACGGGGATCTGATACCCTGGCTCGTGAGCCAGCAATTCCAGGACGAG
GACTTTGCATCCTTGTCGGGCGCGCGCATCGTGAGGATAGCAACCAACCCGGAATACGTGTCCATGGGCTACGGG
ACAAAGGCACTGCAGCTCCTCGTCGACTTTTATGAGGGCCGCTTCGCCAGTCTGTCGGAAGAGGACGACCAAAGA
ACGGAGGAGAGGGTGGAGCGGGCAACGGACGCAGAGCTGGCCAAGACGTCACTGCTGGAGGAGGAGATCACTGTC
CGAGACCAGGCCAAGATGCCCCCCCTCTTCGCGAAGCTCCGGGAGAGGAAGCCGGAAGCGCTCGACTACCTCGGC
GTCAGCTACGGCCTGACGGGGCCCCTGCACAAGTTCTGGAAGCGGTCCAGTTTCTCGCCCGTCTACCTTCGGCAA
ACGGCCAACGGCCTGACGGGCGAGCACACGTGCGTCATGCTGCGGCCGCTCGACAACAGCCAGGACAGGAGCTGG
CTCGGGGCGTTCTCGCGAGACTTCCAGAAGCGCTTCCTGTCGCTCCTGTCGTACCAGTTTCGCACGTTCGCGACC
AAGACGGCGCTGGGGATCGACGAGTCGGCCCGGCGCGGGGCCAGTCTGGACGCGGTCGAGACGGCGCCGCTGGAC
AAGGCGGAGCTGGACCGGCACCTGACGCCCTTCGACCTGAAGCGGCTGGAGTCGTACGCGAACAACATGCTCGAC
TACCACGTCATCCTCGACATGCTCCCGACGATCGCCGCCCTCTTCTTCGGCGGCAAGCTGAAGGCGGACGTCCGG
CTGACGGGCGTGCAGCAGTGGTGCGCAAGGTGA
Gene >Hirsu2|9667
ATGTCGCGAAAACAGCTGTAAGCGCTTGACTTTTGGTCCCCCCCCCTCGCTTCCGCCCATTCGACGGCGTCCGGC
CTTTCATCTCTCTGACACCCGTCGACAGGGACCAGCGCATCCAGACTCTCATCCGCAATGGCCTGCAGGAGAAGA
AGAGGAGCTTCTTCGTCGTCGTCGGCGATCGATCCAAGGATGTCATCGTGTACTTGCATCACATCATGTCTAGCA
TGGACATCAAGCAGAACAAGTCCGTCCTGTGGGCGTATAAGAGCAAGCTGCTTGGATTCACGAGGTGCGCCAGTG
CTGTTACCTGTTTTCCTCACCTCTGGGAAGGAATGCGGCCGCTGATCGTTGACGCGACTCGCATCTAGCCATCGG
AAGAAGCGCGAGCAGAAGATCAAGAAGGAGATCAAGCGCGGCATCCGCGAAGCCAACGCCGAGGACCCCTTCGAG
CTCTTCGTCTCCCTGCACAACATCCGATACACGTACTACAAGGAGACGGACAAAATCCTCGGCAACACCTTCGGC
ATGTGCGTCCTGCAGGACTTCGAGGCCCTGACGCCCAACATCCTGGCCCGCACCATCGAGACGGTCGAGGGCGGC
GGCTTGGTCATCATGCTGCTCAAGGGCATGAACAGTCTGAGACAGCTGTACAACCTGTCGATGGACGTCCACTCC
AGGTACCGCACAGAGGCGCATAAGGAAGTGGTGGCGAGGTTCAACGAGCGATTCCTGCTGTCTCTCGGCCGTTGT
GACTCCTGTCTCGTCATCGACGACGAACTCAACGTCCTGCCCATATCCGGTGGCAAAGACGTCAAGGCCCTGCCC
CCGCCGGACCTGGACCAGCCCAAGACGCCGGAGCAGATGGAGCTGGAAAGCGTCAAGGATGAGCATCGAGAACAG
GAACCGGTCGGCTCCCTCATCTCCCTCGCTAAGTCGGTTGACCAAGCCAAGGCGCTCCTGACCTTCACCGAAGCC
ATTGCCGAGAAGACGCTGAGAAGCACCGTCGCTCTGACGGCCGCCAGAGGTCGAGGCAAGTCGGCCGCCATGGGT
GTGGCCGTCGCGGCGGCCGTCGCGTACGGATACAGCAACATCTTCATCACGTCGCCCTCGCCGGAGAACTTGAAG
ACGCTCTTCGAGTTCATCTTCAAGGGCTTCGATGCCTTGGACTATGCCGACCACGCCGACTATACCATCATTCAG
AGCACCAACCCCGACTTCAACAAGGCCATCGTCCGCGTCAACATCCACAGGCAACACCGTCAGACCATTCAGTAC
ATCCGGCCGCAGGATGCGCACGTGCTGGGCCAGGCAGAGCTTGTCGTCATCGACGAGGCCGCCGCCATCCCCTTG
CCGCTCGTCAAGAAGCTCATGGGCCCGTATCTGGTCTTCATGGCCTCCACAATCAACGGCTACGAAGGCACCGGC
CGTTCGCTTTCACTCAAGCTCATCAAACAGCTGCGGGAAGAGTCGCGCTCTGCCTCTTCCAGGAACGGAGACACC
GAGCTCGCCGATAGATCGACGGGCAAGGCGGCCAAGGTTGCCGAGTACCAGTCGGCTCGGAAGCTGCGAGAAATC
ACGCTCGCCGAGCCCATCCGATATACCCGCGGCGATGCGGTCGAGAAGTGGCTGAACAAGCTTCTATGTCTCGAC
GCGACGCTGCCCAAGTCCAAGTCCAACGTCTACGGATGTCCCGACCCGTCCCAGTGCGAGCTCCTGGCCGTCAAC
CGGGACACACTCTTCTCCTTCCATCCGGTGTCCGAGGCGTTCCTGCAGCAGATGGTGGCCCTGTACGTTGCTAGC
CACTACAAGAACTCACCGGACGACCTGCAGCTCATGAGCGACGCGCCGGCGCACGAGCTCTTTGTCCTGGTGCCG
CCCAACGTGGAGGGCAGCGGAAAGCTGCCGGAGCCGCTGTGCGTCATCCAAGTAGCCCTGGAGGGAAAGATCAGC
AGACAGAGCGTGCTCAACAGCCTGAGCCGAGGGCAGCGGCCGCACGGGGATCTGATACCCTGGCTCGTGAGCCAG
CAATTCCAGGACGAGGACTTTGCATCCTTGTCGGGCGCGCGCATCGTGAGGATAGCAACCAACCCGGAATACGTG
TCCATGGGCTACGGGACAAAGGCACTGCAGCTCCTCGTCGACTTTTATGAGGGCCGCTTCGCCAGTCTGTCGGAA
GAGGACGACCAAAGAACGGAGGAGAGGGTGGAGCGGGCAACGGACGCAGAGCTGGCCAAGACGTCACTGCTGGAG
GAGGAGATCACTGTCCGAGACCAGGCCAAGATGCCCCCCCTCTTCGCGAAGCTCCGGGAGAGGAAGCCGGAAGCG
CTCGACTACCTCGGCGTCAGCTACGGCCTGACGGGGCCCCTGCACAAGTTCTGGAAGCGGTCCAGTTTCTCGCCC
GTCTACCTTCGGCAAACGGCCAACGGCCTGACGGGCGAGCACACGTGCGTCATGCTGCGGCCGCTCGACAACAGC
CAGGACAGGAGCTGGCTCGGGGCGTTCTCGCGAGACTTCCAGAAGCGCTTCCTGTCGCTCCTGTCGTACCAGTTT
CGCACGTTCGCGACCAAGACGGCGCTGGGGATCGACGAGTCGGCCCGGCGCGGGGCCAGTCTGGACGCGGTCGAG
ACGGCGCCGCTGGACAAGGCGGAGCTGGACCGGCACCTGACGCCCTTCGACCTGAAGCGGCTGGAGTCGTACGCG
AACAACATGCTCGACTACCACGTCATCCTCGACATGCTCCCGACGATCGCCGCCCTCTTCTTCGGCGGCAAGCTG
AAGGCGGACGTCCGGCTGACGGGCGTGCAGCAGTGCATCCTGCTGGGCATGGGCCTGCAGCGCAAGGACGTGGAC
GCGGTGGCGCAGGAGCTCGGCCTGCCGGCGGGCCAGCTGCTGGCCATGTTCATCAAGGTGGTGCGCAAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail