Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9664
Gene name
LocationContig_718:1102..5064
Strand+
Gene length (bp)3962
Transcript length (bp)3786
Coding sequence length (bp)3786
Protein length (aa) 1262

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00168 C2 C2 domain 4.5E-13 619 727
PF00168 C2 C2 domain 1.5E-05 841 949

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USG8|MU190_SCHPO Meiotically up-regulated gene 190 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug190 PE=1 SV=1 119 1094 1.0E-112
sp|Q9UT00|YKH3_SCHPO Uncharacterized protein PYUK71.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPYUK71.03c PE=1 SV=1 513 757 2.0E-09
sp|Q5M7N9|ESYT3_XENTR Extended synaptotagmin-3 OS=Xenopus tropicalis GN=esyt3 PE=2 SV=1 489 751 2.0E-08
sp|Q93XX4|C2D61_ARATH C2 domain-containing protein At1g53590 OS=Arabidopsis thaliana GN=NTMC2T6.1 PE=1 SV=2 502 737 2.0E-07
sp|Q3U7R1|ESYT1_MOUSE Extended synaptotagmin-1 OS=Mus musculus GN=Esyt1 PE=1 SV=2 528 682 8.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USG8|MU190_SCHPO Meiotically up-regulated gene 190 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug190 PE=1 SV=1 119 1094 1.0E-112
sp|Q9UT00|YKH3_SCHPO Uncharacterized protein PYUK71.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPYUK71.03c PE=1 SV=1 513 757 2.0E-09
sp|Q5M7N9|ESYT3_XENTR Extended synaptotagmin-3 OS=Xenopus tropicalis GN=esyt3 PE=2 SV=1 489 751 2.0E-08
sp|Q93XX4|C2D61_ARATH C2 domain-containing protein At1g53590 OS=Arabidopsis thaliana GN=NTMC2T6.1 PE=1 SV=2 502 737 2.0E-07
sp|Q3U7R1|ESYT1_MOUSE Extended synaptotagmin-1 OS=Mus musculus GN=Esyt1 PE=1 SV=2 528 682 8.0E-07
sp|Q9Z1X1|ESYT1_RAT Extended synaptotagmin-1 OS=Rattus norvegicus GN=Esyt1 PE=1 SV=1 528 682 2.0E-06
sp|Q9BSJ8|ESYT1_HUMAN Extended synaptotagmin-1 OS=Homo sapiens GN=ESYT1 PE=1 SV=1 528 682 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

Domain # Start End Length
1 221 243 22
2 278 300 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9664
MSGKMDEAEEARRYQAPYSARRPIPTISKYREERAARQLEALRGINDDEDDDVSADDDAASAEDAASYLGLGPNR
AEARPATPAPSTKVGSDGPAAGSSVFLDEDVLRDTSQVSPGTADPKHRRRLLRHRKRERAEREVTDPVTHLPVTI
HDFTDDALDELDFNQPSFGSTPETASGLAAKHKSAEQLLGEKLSMQRDHDLLVNRFPPPDFDVLGRHMTAIFRRG
LTIGLAGMGLIVFGTVALERRTNRDDDAAAAAAPSPAAACLPATGPARSVASWLGWAACSAAAAAALIAAVQGYT
ARKVRNIFQDELWDAQRRQTEARAGRNEAESTAWLNSLLGSVWPLINPDLFASLSDTLEDVMQASLPRLVRMVSV
EDIGQGSEALRILGVRWLPTGAAAQSVTRDGNLSSEEHYENDVDGGGETDGDDDSDEDDEDGHQGGHHHGGGGGG
HENNNNKPPAQDKGHDILDGMEGEEGDFVNLEVAIAYRTRSSSKSLKDRTKDMHLYLAFYLPGNVKIPVWVDLQG
IIGIMRLRLQLTPDPPFFALCTMTFLGQPKVDLSCVPLSQRGLNIMDVPLISKFVQSAVDAAVAEYVAPKSLTLD
LKDMLAGDDFKKDTTAVGVLVVNIKRGYDFKMGDAGIPFFKEGSSDPYVSVGWAKFGKVLWSTRVLTCEMEPYWD
ETCFVVVSPEELNIEERLRVQLWDSDRFTADDDLGRIEVPLRELMGDERSRGTMWSRVDGFRALNAGGSMPGKLE
WAVGYYAKTQLQPCQFERQTHDPEIRSMRQLRESVEQTCERKLREAVFKEHVTARNEAELEQLKAQELKSVQDAI
IISAPPPDDFPSGLLSLQIHNITGLELDKLNKRQAENDDEASDEEETGEDLPSSYCTVIINHSKTFKTRTKPQNA
KPFFNAGCERFIRDWRECEVFISVRDARLHEDNPLLGIVHLPLGDVFRERSQVMGFWPLTGGIGHGRIRLSLVWR
SLRLQAPRSLLGWGYGTVDVQPVVDSPDCSDALRACKLKLKTNISMGKMHPIDGGGGEARWSAKKQQNLSLAVTK
RYSSCMSITFKHKGFFGDKVAAFCVLWLKDIPDEEGQDLHLPIWKGDLERATACCLEVCGERVGTLRLKLTFWAG
MGSAHSRWASRGQNLRDVVEVIDTARDNLDTSRMQKEAGIVDEEASSDSDSSDSDGDKHSRHSVPDGSAAHRQGP
LDQLRDYRRRDKALHRQHRGIMQWKIPRTARWMKHKIERVGDGVSGLFDHHSKQAGIETEV*
Coding >Hirsu2|9664
ATGTCGGGAAAGATGGATGAGGCGGAGGAGGCGCGGCGGTACCAGGCGCCGTACAGCGCGCGGCGGCCCATCCCC
ACCATCTCCAAGTACCGCGAGGAGCGGGCGGCGCGGCAGCTGGAGGCCCTCCGGGGCATCAACGACGATGAAGAC
GACGACGTCTCGGCCGACGACGACGCCGCCTCGGCCGAGGATGCCGCCTCGTACCTGGGCCTGGGGCCCAACCGG
GCCGAGGCGCGGCCGGCGACGCCCGCGCCGAGCACCAAGGTCGGGAGCGACGGCCCGGCCGCGGGCAGCAGCGTC
TTCCTCGACGAGGATGTCCTCCGCGACACGTCGCAGGTCAGCCCCGGCACGGCCGACCCCAAGCACCGGCGGCGG
CTGCTGCGGCACCGCAAGCGCGAGCGGGCCGAGCGCGAGGTCACCGATCCCGTCACCCACCTGCCCGTCACCATC
CACGACTTTACCGACGACGCGCTCGACGAGCTCGACTTCAACCAGCCGTCCTTCGGCTCCACGCCCGAGACGGCC
TCCGGCCTGGCCGCCAAGCACAAGTCGGCCGAGCAGCTGCTGGGCGAGAAGCTGTCGATGCAGCGCGACCACGAC
CTGCTCGTCAACCGCTTCCCGCCCCCGGACTTCGACGTCCTCGGCCGCCACATGACGGCCATCTTCCGCCGCGGC
CTGACCATCGGCCTGGCCGGCATGGGCCTCATCGTCTTCGGAACCGTCGCCCTCGAGAGACGGACGAACCGGGAC
GACGACGCCGCGGCCGCGGCCGCCCCCTCGCCCGCGGCCGCCTGTCTGCCGGCCACGGGCCCCGCTCGCAGCGTT
GCCTCGTGGCTCGGCTGGGCCGCCTGTAGCGCCGCCGCCGCCGCCGCCCTCATCGCCGCCGTCCAGGGCTACACC
GCCCGCAAGGTCCGCAACATCTTTCAGGACGAGCTGTGGGACGCCCAGCGGCGGCAGACCGAGGCCCGGGCCGGC
CGCAACGAGGCCGAGTCGACCGCCTGGCTCAACTCGCTGCTCGGCTCCGTCTGGCCTCTCATCAACCCGGACCTG
TTTGCCAGCCTGTCCGACACGCTCGAGGACGTCATGCAGGCCTCACTGCCGCGGCTCGTCCGCATGGTCAGCGTC
GAGGACATCGGACAGGGTAGCGAGGCGCTCCGCATCCTCGGCGTCCGCTGGCTGCCCACCGGCGCCGCCGCCCAG
TCCGTCACCAGGGACGGGAACCTGTCGTCCGAGGAGCACTATGAGAACGACGTCGACGGCGGCGGCGAAACCGAC
GGAGACGACGACTCGGACGAAGATGACGAGGACGGCCACCAAGGCGGCCACCACCACGGCGGCGGCGGCGGCGGT
CATGAAAACAATAACAACAAGCCACCCGCCCAGGATAAGGGCCACGACATCCTCGACGGCATGGAGGGCGAGGAG
GGCGACTTCGTCAACCTCGAGGTCGCCATTGCCTACCGCACGCGCTCCAGCTCCAAGAGCCTCAAGGACCGCACC
AAGGACATGCACCTGTACCTCGCCTTCTACCTGCCCGGCAACGTCAAGATACCCGTTTGGGTCGACCTGCAGGGC
ATCATCGGCATCATGAGGCTGCGTCTGCAGCTCACCCCGGACCCGCCCTTCTTCGCCCTCTGCACCATGACCTTC
CTCGGCCAGCCCAAGGTCGACCTGAGCTGCGTGCCGCTCAGCCAGCGCGGCCTCAACATCATGGACGTCCCGCTC
ATCAGCAAATTCGTCCAGTCGGCTGTCGACGCCGCCGTGGCCGAGTACGTCGCACCCAAGAGTCTCACCCTCGAC
CTCAAGGACATGCTGGCCGGCGACGACTTCAAGAAGGACACGACGGCCGTCGGCGTGCTCGTAGTCAACATCAAG
CGCGGCTACGACTTCAAGATGGGCGACGCCGGCATCCCCTTCTTCAAGGAGGGCAGCTCGGACCCGTACGTCTCC
GTCGGCTGGGCCAAGTTCGGCAAGGTCCTCTGGAGCACACGCGTCCTGACCTGCGAGATGGAGCCCTACTGGGAC
GAGACCTGCTTCGTCGTCGTCTCGCCCGAGGAGCTCAACATCGAGGAGCGGCTGCGCGTCCAGCTGTGGGACTCG
GACCGCTTTACCGCCGACGACGACCTGGGCCGCATCGAGGTGCCGCTGCGGGAGCTCATGGGCGACGAGCGCTCC
CGCGGCACCATGTGGAGCCGCGTCGACGGCTTCAGGGCGCTCAACGCCGGCGGCAGCATGCCCGGCAAGCTGGAA
TGGGCAGTGGGCTACTACGCCAAGACGCAGTTGCAGCCGTGCCAGTTCGAGCGGCAGACGCACGACCCCGAGATT
CGCTCCATGCGGCAACTCCGCGAGTCCGTCGAGCAGACTTGCGAGAGGAAGCTGCGCGAGGCCGTCTTCAAGGAG
CACGTCACGGCCCGCAACGAGGCCGAGCTGGAACAGCTCAAGGCCCAGGAGCTCAAGAGCGTGCAGGACGCCATC
ATCATTTCGGCCCCGCCCCCGGACGACTTCCCCAGCGGCCTGCTCAGCCTGCAGATCCACAACATCACCGGGCTC
GAGCTCGACAAGCTCAACAAGCGGCAGGCCGAGAACGATGACGAGGCCAGCGACGAGGAGGAGACGGGCGAGGAC
CTGCCGAGCTCCTATTGCACCGTCATCATCAACCATAGCAAGACGTTCAAGACGCGGACGAAGCCGCAGAACGCC
AAGCCCTTCTTCAACGCCGGCTGCGAGCGCTTCATCCGCGACTGGAGGGAGTGTGAGGTCTTCATCTCGGTCCGG
GACGCCAGGCTGCACGAGGACAACCCGCTGCTGGGCATCGTGCACCTGCCGCTTGGCGACGTATTCCGAGAGCGG
TCGCAGGTCATGGGCTTCTGGCCGCTGACGGGCGGTATCGGCCACGGCCGCATCAGGCTGTCATTGGTTTGGCGG
AGCTTGCGCCTCCAGGCGCCGCGGAGCCTGCTTGGCTGGGGCTACGGCACCGTCGACGTGCAGCCGGTCGTCGAC
AGCCCGGACTGCTCCGACGCGCTCAGGGCCTGCAAGCTCAAGCTCAAGACCAACATCAGCATGGGCAAGATGCAC
CCTATAGACGGGGGCGGCGGCGAGGCCCGATGGAGCGCCAAGAAGCAGCAAAACCTCAGCCTGGCCGTGACGAAG
CGGTACAGCAGTTGCATGTCCATCACCTTCAAGCACAAGGGCTTCTTCGGCGACAAGGTCGCGGCCTTTTGCGTC
TTGTGGCTCAAGGACATCCCCGATGAGGAGGGGCAGGACCTCCACCTCCCCATCTGGAAAGGGGATCTGGAGCGG
GCCACCGCCTGCTGCCTGGAGGTTTGCGGCGAAAGGGTCGGAACCTTGCGGCTGAAGCTGACGTTTTGGGCCGGC
ATGGGGAGCGCGCATTCTCGATGGGCATCGCGCGGCCAGAACCTGCGTGATGTGGTCGAAGTCATCGACACGGCA
CGAGACAACCTCGACACGAGCCGAATGCAGAAGGAGGCGGGCATCGTTGACGAGGAGGCGTCGAGCGATAGCGAC
AGCTCCGACAGCGACGGCGACAAGCACAGCCGCCACTCGGTCCCGGACGGCAGCGCGGCACATAGGCAGGGACCG
CTGGACCAGCTTCGGGATTACCGGAGGCGCGACAAGGCGCTGCATCGGCAGCACCGGGGCATCATGCAATGGAAG
ATCCCGCGAACGGCACGGTGGATGAAGCACAAGATTGAGAGAGTGGGGGACGGCGTGAGCGGGCTATTCGATCAT
CATTCGAAGCAGGCAGGCATCGAGACGGAGGTGTAG
Transcript >Hirsu2|9664
ATGTCGGGAAAGATGGATGAGGCGGAGGAGGCGCGGCGGTACCAGGCGCCGTACAGCGCGCGGCGGCCCATCCCC
ACCATCTCCAAGTACCGCGAGGAGCGGGCGGCGCGGCAGCTGGAGGCCCTCCGGGGCATCAACGACGATGAAGAC
GACGACGTCTCGGCCGACGACGACGCCGCCTCGGCCGAGGATGCCGCCTCGTACCTGGGCCTGGGGCCCAACCGG
GCCGAGGCGCGGCCGGCGACGCCCGCGCCGAGCACCAAGGTCGGGAGCGACGGCCCGGCCGCGGGCAGCAGCGTC
TTCCTCGACGAGGATGTCCTCCGCGACACGTCGCAGGTCAGCCCCGGCACGGCCGACCCCAAGCACCGGCGGCGG
CTGCTGCGGCACCGCAAGCGCGAGCGGGCCGAGCGCGAGGTCACCGATCCCGTCACCCACCTGCCCGTCACCATC
CACGACTTTACCGACGACGCGCTCGACGAGCTCGACTTCAACCAGCCGTCCTTCGGCTCCACGCCCGAGACGGCC
TCCGGCCTGGCCGCCAAGCACAAGTCGGCCGAGCAGCTGCTGGGCGAGAAGCTGTCGATGCAGCGCGACCACGAC
CTGCTCGTCAACCGCTTCCCGCCCCCGGACTTCGACGTCCTCGGCCGCCACATGACGGCCATCTTCCGCCGCGGC
CTGACCATCGGCCTGGCCGGCATGGGCCTCATCGTCTTCGGAACCGTCGCCCTCGAGAGACGGACGAACCGGGAC
GACGACGCCGCGGCCGCGGCCGCCCCCTCGCCCGCGGCCGCCTGTCTGCCGGCCACGGGCCCCGCTCGCAGCGTT
GCCTCGTGGCTCGGCTGGGCCGCCTGTAGCGCCGCCGCCGCCGCCGCCCTCATCGCCGCCGTCCAGGGCTACACC
GCCCGCAAGGTCCGCAACATCTTTCAGGACGAGCTGTGGGACGCCCAGCGGCGGCAGACCGAGGCCCGGGCCGGC
CGCAACGAGGCCGAGTCGACCGCCTGGCTCAACTCGCTGCTCGGCTCCGTCTGGCCTCTCATCAACCCGGACCTG
TTTGCCAGCCTGTCCGACACGCTCGAGGACGTCATGCAGGCCTCACTGCCGCGGCTCGTCCGCATGGTCAGCGTC
GAGGACATCGGACAGGGTAGCGAGGCGCTCCGCATCCTCGGCGTCCGCTGGCTGCCCACCGGCGCCGCCGCCCAG
TCCGTCACCAGGGACGGGAACCTGTCGTCCGAGGAGCACTATGAGAACGACGTCGACGGCGGCGGCGAAACCGAC
GGAGACGACGACTCGGACGAAGATGACGAGGACGGCCACCAAGGCGGCCACCACCACGGCGGCGGCGGCGGCGGT
CATGAAAACAATAACAACAAGCCACCCGCCCAGGATAAGGGCCACGACATCCTCGACGGCATGGAGGGCGAGGAG
GGCGACTTCGTCAACCTCGAGGTCGCCATTGCCTACCGCACGCGCTCCAGCTCCAAGAGCCTCAAGGACCGCACC
AAGGACATGCACCTGTACCTCGCCTTCTACCTGCCCGGCAACGTCAAGATACCCGTTTGGGTCGACCTGCAGGGC
ATCATCGGCATCATGAGGCTGCGTCTGCAGCTCACCCCGGACCCGCCCTTCTTCGCCCTCTGCACCATGACCTTC
CTCGGCCAGCCCAAGGTCGACCTGAGCTGCGTGCCGCTCAGCCAGCGCGGCCTCAACATCATGGACGTCCCGCTC
ATCAGCAAATTCGTCCAGTCGGCTGTCGACGCCGCCGTGGCCGAGTACGTCGCACCCAAGAGTCTCACCCTCGAC
CTCAAGGACATGCTGGCCGGCGACGACTTCAAGAAGGACACGACGGCCGTCGGCGTGCTCGTAGTCAACATCAAG
CGCGGCTACGACTTCAAGATGGGCGACGCCGGCATCCCCTTCTTCAAGGAGGGCAGCTCGGACCCGTACGTCTCC
GTCGGCTGGGCCAAGTTCGGCAAGGTCCTCTGGAGCACACGCGTCCTGACCTGCGAGATGGAGCCCTACTGGGAC
GAGACCTGCTTCGTCGTCGTCTCGCCCGAGGAGCTCAACATCGAGGAGCGGCTGCGCGTCCAGCTGTGGGACTCG
GACCGCTTTACCGCCGACGACGACCTGGGCCGCATCGAGGTGCCGCTGCGGGAGCTCATGGGCGACGAGCGCTCC
CGCGGCACCATGTGGAGCCGCGTCGACGGCTTCAGGGCGCTCAACGCCGGCGGCAGCATGCCCGGCAAGCTGGAA
TGGGCAGTGGGCTACTACGCCAAGACGCAGTTGCAGCCGTGCCAGTTCGAGCGGCAGACGCACGACCCCGAGATT
CGCTCCATGCGGCAACTCCGCGAGTCCGTCGAGCAGACTTGCGAGAGGAAGCTGCGCGAGGCCGTCTTCAAGGAG
CACGTCACGGCCCGCAACGAGGCCGAGCTGGAACAGCTCAAGGCCCAGGAGCTCAAGAGCGTGCAGGACGCCATC
ATCATTTCGGCCCCGCCCCCGGACGACTTCCCCAGCGGCCTGCTCAGCCTGCAGATCCACAACATCACCGGGCTC
GAGCTCGACAAGCTCAACAAGCGGCAGGCCGAGAACGATGACGAGGCCAGCGACGAGGAGGAGACGGGCGAGGAC
CTGCCGAGCTCCTATTGCACCGTCATCATCAACCATAGCAAGACGTTCAAGACGCGGACGAAGCCGCAGAACGCC
AAGCCCTTCTTCAACGCCGGCTGCGAGCGCTTCATCCGCGACTGGAGGGAGTGTGAGGTCTTCATCTCGGTCCGG
GACGCCAGGCTGCACGAGGACAACCCGCTGCTGGGCATCGTGCACCTGCCGCTTGGCGACGTATTCCGAGAGCGG
TCGCAGGTCATGGGCTTCTGGCCGCTGACGGGCGGTATCGGCCACGGCCGCATCAGGCTGTCATTGGTTTGGCGG
AGCTTGCGCCTCCAGGCGCCGCGGAGCCTGCTTGGCTGGGGCTACGGCACCGTCGACGTGCAGCCGGTCGTCGAC
AGCCCGGACTGCTCCGACGCGCTCAGGGCCTGCAAGCTCAAGCTCAAGACCAACATCAGCATGGGCAAGATGCAC
CCTATAGACGGGGGCGGCGGCGAGGCCCGATGGAGCGCCAAGAAGCAGCAAAACCTCAGCCTGGCCGTGACGAAG
CGGTACAGCAGTTGCATGTCCATCACCTTCAAGCACAAGGGCTTCTTCGGCGACAAGGTCGCGGCCTTTTGCGTC
TTGTGGCTCAAGGACATCCCCGATGAGGAGGGGCAGGACCTCCACCTCCCCATCTGGAAAGGGGATCTGGAGCGG
GCCACCGCCTGCTGCCTGGAGGTTTGCGGCGAAAGGGTCGGAACCTTGCGGCTGAAGCTGACGTTTTGGGCCGGC
ATGGGGAGCGCGCATTCTCGATGGGCATCGCGCGGCCAGAACCTGCGTGATGTGGTCGAAGTCATCGACACGGCA
CGAGACAACCTCGACACGAGCCGAATGCAGAAGGAGGCGGGCATCGTTGACGAGGAGGCGTCGAGCGATAGCGAC
AGCTCCGACAGCGACGGCGACAAGCACAGCCGCCACTCGGTCCCGGACGGCAGCGCGGCACATAGGCAGGGACCG
CTGGACCAGCTTCGGGATTACCGGAGGCGCGACAAGGCGCTGCATCGGCAGCACCGGGGCATCATGCAATGGAAG
ATCCCGCGAACGGCACGGTGGATGAAGCACAAGATTGAGAGAGTGGGGGACGGCGTGAGCGGGCTATTCGATCAT
CATTCGAAGCAGGCAGGCATCGAGACGGAGGTGTAG
Gene >Hirsu2|9664
ATGTCGGGAAAGATGGATGAGGCGGAGGAGGCGCGGCGGTACCAGGCGCCGTACAGCGCGCGGCGGCCCATCCCC
ACCATCTCCAAGTACCGCGAGGAGCGGGCGGCGCGGCAGCTGGAGGCCCTCCGGGGCATCAACGACGATGAAGAC
GACGACGTCTCGGCCGACGACGACGCCGCCTCGGCCGAGGATGCCGCCTCGTACCTGGGCCTGGGGCCCAACCGG
GCCGAGGCGCGGCCGGCGACGCCCGCGCCGAGCACCAAGGTCGGGAGCGACGGCCCGGCCGCGGGCAGCAGCGTC
TTCCTCGACGAGGATGTCCTCCGCGACACGTCGCAGGTCAGCCCCGGCACGGCCGACCCCAAGCACCGGCGGCGG
CTGCTGCGGCACCGCAAGCGCGAGCGGGCCGAGCGCGAGGTCACCGATCCCGTCACCCACCTGCCCGTCACCATC
CACGACTTTACCGACGACGCGCTCGACGAGCTCGACTTCAACCAGCCGTCCTTCGGCTCCACGCCCGAGACGGCC
TCCGGCCTGGCCGCCAAGCACAAGTCGGCCGAGCAGCTGCTGGGCGAGAAGCTGTCGATGCAGCGCGACCACGAC
CTGCTCGTCAACCGCTTCCCGCCCCCGGACTTCGACGTCCTCGGCCGCCACATGACGGCCATCTTCCGCCGCGGC
CTGACCATCGGCCTGGCCGGCATGGGCCTCATCGTCTTCGGAACCGTCGCCCTCGAGAGACGGACGAACCGGGAC
GACGACGCCGCGGCCGCGGCCGCCCCCTCGCCCGCGGCCGCCTGTCTGCCGGCCACGGGCCCCGCTCGCAGCGTT
GCCTCGTGGCTCGGCTGGGCCGCCTGTAGCGCCGCCGCCGCCGCCGCCCTCATCGCCGCCGTCCAGGGCTACACC
GCCCGCAAGGTCCGCAACATCTTTCAGGACGAGCTGTGGGACGCCCAGCGGCGGCAGACCGAGGCCCGGGCCGGC
CGCAACGAGGCCGAGTCGACCGCCTGGCTCAACTCGCTGCTCGGCTCCGTCTGGCCTCTCATCAACCCGGACCTG
TTTGCCAGCCTGTCCGACACGCTCGAGGACGTCATGCAGGCCTCACTGCCGCGGCTCGTCCGCATGGTCAGCGTC
GAGGACATCGGACAGGGTAGCGAGGCGCTCCGCATCCTCGGCGTCCGCTGGCTGCCCACCGGCGCCGCCGCCCAG
TCCGTCACCAGGGACGGGAACCTGTCGTCCGAGGAGCACTATGAGAACGACGTCGACGGCGGCGGCGAAACCGAC
GGAGACGACGACTCGGACGAAGATGACGAGGACGGCCACCAAGGCGGCCACCACCACGGCGGCGGCGGCGGCGGT
CATGAAAACAATAACAACAAGCCACCCGCCCAGGATAAGGGCCACGACATCCTCGACGGCATGGAGGGCGAGGAG
GGCGACTTCGTCAACCTCGAGGTCGCCATTGCCTACCGCACGCGCTCCAGCTCCAAGAGCCTCAAGGACCGCACC
AAGGACATGCACCTGTACCTCGCCTTCTACCTGCCCGGCAACGTCAAGATACCCGTTTGGGTCGACCTGCAGGGC
ATCATCGGCATCATGAGGCTGCGTCTGCAGCTCACCCCGGACCCGCCCTTCTTCGCCCTCTGCACCATGACCTTC
CTCGGCCAGCCCAAGGTCGACCTGAGCTGCGTGCCGCTCAGCCAGCGCGGCCTCAACATCATGGACGTCCCGCTC
ATCAGCAAATTCGTCCAGTCGGCTGTCGACGCCGCCGTGGCCGAGTACGTCGCACCCAAGAGTCTCACCCTCGAC
CTCAAGGACATGCTGGCCGGCGACGACTTCAAGAAGGACACGACGGCCGTCGGCGTGCTCGTAGTCAACATCAAG
CGCGGCTACGACTTCAAGATGGGCGACGCCGGCATCCCCTTCTTCAAGGAGGGCAGCTCGGACCCGTACGTCTCC
GTCGGCTGGGCCAAGTTCGGCAAGGTCCTCTGGAGCACACGCGTCCTGACCTGCGAGATGGAGCCCTACTGGGAC
GAGACCTGCTTCGTCGTCGTCTCGCCCGAGGAGCTCAACATCGAGGAGCGGCTGCGCGTCCAGCTGTGGGACTCG
GACCGCTTTACCGCCGACGACGACCTGGGCCGCATCGAGGTGCCGCTGCGGGAGCTCATGGGCGACGAGCGCTCC
CGCGGCACCATGTGGAGCCGCGTCGACGGCTTCAGGGCGCTCAACGCCGGCGGCAGCATGCCCGGCAAGCTGGAA
TGGGCAGTGGGCTACTACGCCAAGACGCAGTTGCAGCCGTGCCAGTTCGAGCGGCAGACGCACGACCCCGAGATT
CGCTCCATGCGGCAACTCCGCGAGTCCGTCGAGCAGACTTGCGAGAGGAAGCTGCGCGAGGCCGTCTTCAAGGAG
CACGTCACGGCCCGCAACGAGGCCGAGCTGGAACAGCTCAAGGCCCAGGAGCTCAAGAGCGTGCAGGACGCCATC
ATCATTTCGGCCCCGCCCCCGGACGACTTCCCCAGCGGCCTGCTCAGCCTGCAGATCCACAACATCACCGGGCTC
GAGCTCGACAAGCTCAACAAGCGGCAGGCCGAGAACGATGACGAGGCCAGCGACGAGGAGGAGACGGGCGAGGAC
CTGCCGAGCTCCTATTGCACCGTCATCATCAACCATAGCAAGACGTTCAAGACGCGGACGAAGCCGCAGAACGCC
AAGCCCTTCTTCAACGCCGGCTGCGAGCGCTTCATCCGCGACTGGAGGGAGTGTGAGGTCTTCATCTCGGTCCGG
GACGCCAGGCTGCACGAGGACAACCCGCTGCTGGGCATCGTGCACCTGCCGCTTGGCGACGTATTCCGAGAGCGG
TCGCAGGTCATGGGCTTCTGGCCGCTGACGGGCGGTATCGGCCACGGCCGCATCAGGCTGTCATTGGTTTGGCGG
AGCTTGCGCCTCCAGGCGCCGCGGAGCCTGCTTGGCTGGGGCTACGGCACCGTCGACGTGCAGCCGGTCGTCGAC
AGCCCGGACTGCTCCGACGCGCTCAGGGCCTGCAAGCTCAAGCTCAAGACCAACATCAGCATGGGCAAGATGCAC
CCTATAGACGGGGGCGGCGGCGAGGCCCGATGGAGCGCCAAGAAGCAGCAAAACCTCAGCCTGGCCGTGACGAAG
CGGTACAGCAGTTGCATGTCCATCACCTTCAAGCACAAGGGCTTCTTCGGCGACAAGGTCGCGGCCTTTTGCGTC
TTGTGGCTCAAGGACATCCCCGATGAGGAGGGGCAGGACCTCCACCTCCCCATCTGGAAAGGGGATCTGGAGCGG
GCCACCGCCTGCTGCCTGGAGGTTTGCGGCGAAAGGGTCGGAACCTTGCGGCTGAAGCTGACGTTTTGGGCCGGC
ATGGTAAGCGATTCCCGGAACGGGTTTGCGAGGTGCGAGTTGCAACGAGCCGGTGATTTTGCTGACCTCCGCCCT
TTCCAATTGTTCAGGGGAGCGCGCATTCTCGATGGGCATCGCGCGGCCAGAACCTGCGTGATGTGGTCGAAGTCA
TCGACACGGCACGAGACAACCTCGACACGAGCCGAATGCAGAAGGAGGCGGGCATCGTTGACGAGGAGGCGTCGA
GCGATAGCGACAGCTCCGACAGCGACGGCGACAAGCACAGCCGCCACTCGGTCCCGGACGGCAGCGCGGCACATA
GGCAGGGACCGCTGGACCAGCTTCGGGATTACCGGAGGCGCGACAAGGCGCTGCATCGGCAGCACCGGGGCATCA
TGCAATGGAAGGTGAGGATCGCGTGCCATGACGGTCGGATTGATTTGGCGCCGCATCGTGAATTGGACTGACTGG
GAGGCTGACTCAAAACTCGCCAACAGATCCCGCGAACGGCACGGTGGATGAAGCACAAGATTGAGAGAGTGGGGG
ACGGCGTGAGCGGGCTATTCGATCATCATTCGAAGCAGGCAGGCATCGAGACGGAGGTGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail