Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9657
Gene name
LocationContig_716:6100..8851
Strand-
Gene length (bp)2751
Transcript length (bp)2448
Coding sequence length (bp)2448
Protein length (aa) 816

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00493 MCM MCM P-loop domain 5.4E-104 380 599
PF17207 MCM_OB MCM OB domain 1.8E-30 208 338
PF17855 MCM_lid MCM AAA-lid domain 1.6E-19 621 706
PF14551 MCM_N MCM N-terminal domain 1.5E-16 16 194
PF01078 Mg_chelatase Magnesium chelatase, subunit ChlI 1.0E-05 489 551
PF07728 AAA_5 AAA domain (dynein-related subfamily) 9.3E-06 436 575

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O75001|MCM7_SCHPO DNA replication licensing factor mcm7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mcm7 PE=1 SV=1 76 802 0.0E+00
sp|P38132|MCM7_YEAST DNA replication licensing factor MCM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCM7 PE=1 SV=4 2 812 0.0E+00
sp|P43299|MCM7_ARATH DNA replication licensing factor MCM7 OS=Arabidopsis thaliana GN=MCM7 PE=1 SV=2 76 802 0.0E+00
sp|B8BMI1|MCM7_ORYSI DNA replication licensing factor MCM7 OS=Oryza sativa subsp. indica GN=MCM7 PE=3 SV=1 78 804 0.0E+00
sp|Q2QNM1|MCM7_ORYSJ DNA replication licensing factor MCM7 OS=Oryza sativa subsp. japonica GN=MCM7 PE=2 SV=1 78 804 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O75001|MCM7_SCHPO DNA replication licensing factor mcm7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mcm7 PE=1 SV=1 76 802 0.0E+00
sp|P38132|MCM7_YEAST DNA replication licensing factor MCM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCM7 PE=1 SV=4 2 812 0.0E+00
sp|P43299|MCM7_ARATH DNA replication licensing factor MCM7 OS=Arabidopsis thaliana GN=MCM7 PE=1 SV=2 76 802 0.0E+00
sp|B8BMI1|MCM7_ORYSI DNA replication licensing factor MCM7 OS=Oryza sativa subsp. indica GN=MCM7 PE=3 SV=1 78 804 0.0E+00
sp|Q2QNM1|MCM7_ORYSJ DNA replication licensing factor MCM7 OS=Oryza sativa subsp. japonica GN=MCM7 PE=2 SV=1 78 804 0.0E+00
sp|Q3ZBH9|MCM7_BOVIN DNA replication licensing factor MCM7 OS=Bos taurus GN=MCM7 PE=2 SV=1 76 802 0.0E+00
sp|P33993|MCM7_HUMAN DNA replication licensing factor MCM7 OS=Homo sapiens GN=MCM7 PE=1 SV=4 76 802 0.0E+00
sp|Q61881|MCM7_MOUSE DNA replication licensing factor MCM7 OS=Mus musculus GN=Mcm7 PE=1 SV=1 78 802 0.0E+00
sp|Q9XYU0|MCM7_DROME DNA replication licensing factor Mcm7 OS=Drosophila melanogaster GN=Mcm7 PE=1 SV=1 79 802 0.0E+00
sp|Q7ZXB1|MCM7B_XENLA DNA replication licensing factor mcm7-B OS=Xenopus laevis GN=mcm7-b PE=2 SV=1 78 802 0.0E+00
sp|Q6NX31|MCM7_XENTR DNA replication licensing factor mcm7 OS=Xenopus tropicalis GN=mcm7 PE=2 SV=1 78 802 0.0E+00
sp|Q91876|MCM7A_XENLA DNA replication licensing factor mcm7-A OS=Xenopus laevis GN=mcm7-a PE=1 SV=2 66 802 0.0E+00
sp|Q0WVF5|MCM4_ARATH DNA replication licensing factor MCM4 OS=Arabidopsis thaliana GN=MCM4 PE=1 SV=1 207 727 1.0E-112
sp|Q5JKB0|MCM4_ORYSJ DNA replication licensing factor MCM4 OS=Oryza sativa subsp. japonica GN=MCM4 PE=3 SV=2 205 733 6.0E-110
sp|Q5XK83|MCM4A_XENLA DNA replication licensing factor mcm4-A OS=Xenopus laevis GN=mcm4-a PE=1 SV=1 201 721 4.0E-107
sp|Q6GL41|MCM4_XENTR DNA replication licensing factor mcm4 OS=Xenopus tropicalis GN=mcm4 PE=2 SV=1 201 721 9.0E-107
sp|P30664|MCM4B_XENLA DNA replication licensing factor mcm4-B OS=Xenopus laevis GN=mcm4-b PE=1 SV=3 201 721 7.0E-106
sp|P53091|MCM6_YEAST DNA replication licensing factor MCM6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCM6 PE=1 SV=2 208 706 8.0E-106
sp|P29458|MCM4_SCHPO DNA replication licensing factor mcm4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mcm4 PE=1 SV=2 204 706 5.0E-104
sp|P49717|MCM4_MOUSE DNA replication licensing factor MCM4 OS=Mus musculus GN=Mcm4 PE=1 SV=1 201 726 5.0E-104
sp|P33991|MCM4_HUMAN DNA replication licensing factor MCM4 OS=Homo sapiens GN=MCM4 PE=1 SV=5 201 726 8.0E-104
sp|F4KAB8|MCM6_ARATH DNA replication licensing factor MCM6 OS=Arabidopsis thaliana GN=MCM6 PE=1 SV=1 186 706 9.0E-104
sp|P49739|MCM3M_XENLA Maternal DNA replication licensing factor mcm3 OS=Xenopus laevis GN=mmcm3 PE=1 SV=2 169 704 2.0E-103
sp|P30665|MCM4_YEAST DNA replication licensing factor MCM4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCM4 PE=1 SV=2 207 722 1.0E-102
sp|P29496|MCM5_YEAST Minichromosome maintenance protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCM5 PE=1 SV=1 203 725 2.0E-101
sp|Q9UXG1|MCM_SULSO Minichromosome maintenance protein MCM OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=MCM PE=1 SV=1 204 740 2.0E-101
sp|P49731|MCM6_SCHPO DNA replication licensing factor mcm6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mcm6 PE=1 SV=2 208 706 4.0E-101
sp|Q9XYU1|MCM3_DROME DNA replication licensing factor Mcm3 OS=Drosophila melanogaster GN=Mcm3 PE=1 SV=1 209 719 4.0E-101
sp|Q26454|MCM4_DROME DNA replication licensing factor MCM4 OS=Drosophila melanogaster GN=dpa PE=1 SV=2 177 726 1.0E-99
sp|P97311|MCM6_MOUSE DNA replication licensing factor MCM6 OS=Mus musculus GN=Mcm6 PE=1 SV=1 208 725 2.0E-99
sp|Q5ZMN2|MCM3_CHICK DNA replication licensing factor MCM3 OS=Gallus gallus GN=MCM3 PE=2 SV=1 203 704 5.0E-99
sp|Q2KIZ8|MCM6_BOVIN DNA replication licensing factor MCM6 OS=Bos taurus GN=MCM6 PE=2 SV=1 208 706 9.0E-99
sp|Q28CM3|MCM6M_XENTR Maternal DNA replication licensing factor mcm6 OS=Xenopus tropicalis GN=mmcm6 PE=2 SV=1 199 706 3.0E-98
sp|A4FUD9|MCM3_BOVIN DNA replication licensing factor MCM3 OS=Bos taurus GN=MCM3 PE=2 SV=1 203 704 4.0E-98
sp|Q14566|MCM6_HUMAN DNA replication licensing factor MCM6 OS=Homo sapiens GN=MCM6 PE=1 SV=1 208 725 5.0E-98
sp|Q9LPD9|MCM2_ARATH DNA replication licensing factor MCM2 OS=Arabidopsis thaliana GN=MCM2 PE=1 SV=1 208 726 6.0E-98
sp|Q5FWY4|MCM6M_XENLA Maternal DNA replication licensing factor mcm6 OS=Xenopus laevis GN=mmcm6 PE=1 SV=1 199 706 7.0E-98
sp|P25206|MCM3_MOUSE DNA replication licensing factor MCM3 OS=Mus musculus GN=Mcm3 PE=1 SV=2 203 704 1.0E-97
sp|Q498J7|MC6ZA_XENLA Zygotic DNA replication licensing factor mcm6-A OS=Xenopus laevis GN=zmcm6-a PE=1 SV=1 208 706 3.0E-97
sp|Q7ZXZ0|MCM3Z_XENLA Zygotic DNA replication licensing factor mcm3 OS=Xenopus laevis GN=zmcm3 PE=1 SV=1 203 704 3.0E-97
sp|Q6P1V8|MCM6Z_XENTR Zygotic DNA replication licensing factor mcm6 OS=Xenopus tropicalis GN=zmcm6 PE=2 SV=1 208 706 4.0E-97
sp|Q28BS0|MCM3Z_XENTR Zygotic DNA replication licensing factor mcm3 OS=Xenopus tropicalis GN=zmcm3 PE=2 SV=1 219 719 4.0E-97
sp|Q7Q0Q1|MCM6_ANOGA DNA replication licensing factor Mcm6 OS=Anopheles gambiae GN=Mcm6 PE=3 SV=3 208 706 4.0E-97
sp|Q7ZY18|MC6ZB_XENLA Zygotic DNA replication licensing factor mcm6-B OS=Xenopus laevis GN=zmcm6-b PE=1 SV=1 208 706 6.0E-97
sp|Q0DHC4|MCM3_ORYSJ DNA replication licensing factor MCM3 OS=Oryza sativa subsp. japonica GN=MCM3 PE=2 SV=1 209 703 8.0E-97
sp|B8AZ99|MCM3_ORYSI DNA replication licensing factor MCM3 OS=Oryza sativa subsp. indica GN=MCM3 PE=3 SV=1 209 703 8.0E-97
sp|P25205|MCM3_HUMAN DNA replication licensing factor MCM3 OS=Homo sapiens GN=MCM3 PE=1 SV=3 203 704 9.0E-97
sp|Q5R8G6|MCM3_PONAB DNA replication licensing factor MCM3 OS=Pongo abelii GN=MCM3 PE=2 SV=1 203 704 1.0E-96
sp|Q43704|MCM31_MAIZE DNA replication licensing factor MCM3 homolog 1 OS=Zea mays GN=ROA1 PE=2 SV=2 209 703 3.0E-96
sp|Q9SX04|MCM32_MAIZE DNA replication licensing factor MCM3 homolog 2 OS=Zea mays GN=ROA2 PE=2 SV=1 209 703 6.0E-96
sp|Q9SX03|MCM33_MAIZE DNA replication licensing factor MCM3 homolog 3 OS=Zea mays GN=ROA3 PE=2 SV=1 209 703 6.0E-96
sp|Q9FL33|MCM3_ARATH DNA replication licensing factor MCM3 OS=Arabidopsis thaliana GN=MCM3 PE=1 SV=1 203 703 6.0E-96
sp|P49735|MCM2_DROME DNA replication licensing factor Mcm2 OS=Drosophila melanogaster GN=Mcm2 PE=1 SV=1 208 717 6.0E-96
sp|Q6PCI7|MCM5B_XENLA DNA replication licensing factor mcm5-B OS=Xenopus laevis GN=mcm5-b PE=2 SV=1 287 725 2.0E-95
sp|P30666|MCM3_SCHPO DNA replication licensing factor mcm3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mcm3 PE=1 SV=2 209 703 7.0E-95
sp|B8BKI8|MCM2_ORYSI DNA replication licensing factor MCM2 OS=Oryza sativa subsp. indica GN=OsI_36121 PE=3 SV=1 208 703 8.0E-95
sp|Q9VGW6|MCM5_DROME DNA replication licensing factor Mcm5 OS=Drosophila melanogaster GN=Mcm5 PE=1 SV=1 208 720 1.0E-94
sp|P55862|MCM5A_XENLA DNA replication licensing factor mcm5-A OS=Xenopus laevis GN=mcm5-a PE=1 SV=2 287 723 1.0E-94
sp|Q561P5|MCM5_XENTR DNA replication licensing factor mcm5 OS=Xenopus tropicalis GN=mcm5 PE=2 SV=1 287 723 2.0E-94
sp|Q9V461|MCM6_DROME DNA replication licensing factor Mcm6 OS=Drosophila melanogaster GN=Mcm6 PE=1 SV=1 208 706 2.0E-94
sp|Q2R482|MCM2_ORYSJ DNA replication licensing factor MCM2 OS=Oryza sativa subsp. japonica GN=MCM2 PE=2 SV=1 208 703 3.0E-94
sp|O80786|MCM5_ARATH DNA replication licensing factor MCM5 OS=Arabidopsis thaliana GN=MCM5 PE=1 SV=1 206 722 3.0E-94
sp|P97310|MCM2_MOUSE DNA replication licensing factor MCM2 OS=Mus musculus GN=Mcm2 PE=1 SV=3 208 706 4.0E-94
sp|P41389|MCM5_SCHPO DNA replication licensing factor mcm5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mcm5 PE=1 SV=2 203 706 5.0E-94
sp|Q29JI9|MCM6_DROPS DNA replication licensing factor Mcm6 OS=Drosophila pseudoobscura pseudoobscura GN=Mcm6 PE=3 SV=1 208 706 7.0E-94
sp|Q6KAJ4|MCM5_ORYSJ DNA replication licensing factor MCM5 OS=Oryza sativa subsp. japonica GN=MCM5 PE=2 SV=1 206 722 2.0E-93
sp|B8AEH3|MCM5_ORYSI DNA replication licensing factor MCM5 OS=Oryza sativa subsp. indica GN=MCM5 PE=3 SV=1 206 722 2.0E-93
sp|P55861|MCM2_XENLA DNA replication licensing factor mcm2 OS=Xenopus laevis GN=mcm2 PE=1 SV=2 146 726 2.0E-93
sp|P49736|MCM2_HUMAN DNA replication licensing factor MCM2 OS=Homo sapiens GN=MCM2 PE=1 SV=4 208 703 4.0E-93
sp|P49718|MCM5_MOUSE DNA replication licensing factor MCM5 OS=Mus musculus GN=Mcm5 PE=1 SV=1 221 723 4.0E-92
sp|Q6DIH3|MCM2_XENTR DNA replication licensing factor mcm2 OS=Xenopus tropicalis GN=mcm2 PE=2 SV=1 51 703 4.0E-92
sp|Q54CP4|MCM5_DICDI DNA replication licensing factor mcm5 OS=Dictyostelium discoideum GN=mcm5 PE=3 SV=1 83 706 5.0E-92
sp|P40377|MCM2_SCHPO DNA replication licensing factor mcm2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mcm2 PE=1 SV=1 206 728 2.0E-91
sp|Q0V8B7|MCM5_BOVIN DNA replication licensing factor MCM5 OS=Bos taurus GN=MCM5 PE=2 SV=1 287 723 5.0E-91
sp|P33992|MCM5_HUMAN DNA replication licensing factor MCM5 OS=Homo sapiens GN=MCM5 PE=1 SV=5 287 723 8.0E-91
sp|P29469|MCM2_YEAST DNA replication licensing factor MCM2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCM2 PE=1 SV=2 207 730 1.0E-90
sp|P24279|MCM3_YEAST DNA replication licensing factor MCM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCM3 PE=1 SV=1 188 603 2.0E-90
sp|P34647|MCM6_CAEEL DNA replication licensing factor mcm-6 OS=Caenorhabditis elegans GN=mcm-6 PE=1 SV=1 208 764 2.0E-90
sp|Q24849|MCM3_ENTHI DNA replication licensing factor MCM3 OS=Entamoeba histolytica GN=MCM3 PE=3 SV=1 209 703 7.0E-90
sp|Q62724|MCM6_RAT DNA replication licensing factor MCM6 (Fragment) OS=Rattus norvegicus GN=Mcm6 PE=1 SV=2 381 706 1.0E-89
sp|Q61J08|MCM6_CAEBR DNA replication licensing factor mcm-6 OS=Caenorhabditis briggsae GN=mcm-6 PE=3 SV=1 208 706 2.0E-89
sp|Q21902|MCM5_CAEEL DNA replication licensing factor mcm-5 OS=Caenorhabditis elegans GN=mcm-5 PE=3 SV=1 207 706 3.0E-88
sp|Q9SF37|MCM8_ARATH Probable DNA helicase MCM8 OS=Arabidopsis thaliana GN=MCM8 PE=2 SV=2 185 710 1.0E-84
sp|B8B406|MCM9_ORYSI Probable DNA helicase MCM9 OS=Oryza sativa subsp. indica GN=MCM9 PE=3 SV=1 146 724 1.0E-84
sp|B8AZX3|MCM6_ORYSI DNA replication licensing factor MCM6 OS=Oryza sativa subsp. indica GN=MCM6 PE=3 SV=1 384 717 2.0E-84
sp|Q6F353|MCM6_ORYSJ DNA replication licensing factor MCM6 OS=Oryza sativa subsp. japonica GN=Os05g0235800 PE=3 SV=1 384 717 2.0E-84
sp|Q69QA6|MCM9_ORYSJ Probable DNA helicase MCM9 OS=Oryza sativa subsp. japonica GN=MCM9 PE=2 SV=1 146 724 5.0E-84
sp|Q86B14|MCM6_DICDI DNA replication licensing factor mcm6 OS=Dictyostelium discoideum GN=mcm6 PE=3 SV=1 382 770 3.0E-83
sp|B8AZ14|MCM8_ORYSI Probable DNA helicase MCM8 OS=Oryza sativa subsp. indica GN=MCM8 PE=3 SV=1 204 706 3.0E-81
sp|B9FKM7|MCM8_ORYSJ Probable DNA helicase MCM8 OS=Oryza sativa subsp. japonica GN=MCM8 PE=2 SV=1 204 706 3.0E-81
sp|Q0V9Q6|MCM8_XENTR DNA helicase MCM8 OS=Xenopus tropicalis GN=mcm8 PE=2 SV=1 208 706 1.0E-78
sp|Q5F310|MCM8_XENLA DNA helicase MCM8 OS=Xenopus laevis GN=mcm8 PE=2 SV=2 207 706 2.0E-77
sp|I0IUP3|MCM8_CHICK DNA helicase MCM8 OS=Gallus gallus GN=MCM8 PE=1 SV=1 208 706 2.0E-77
sp|D3ZVK1|MCM8_RAT DNA helicase MCM8 OS=Rattus norvegicus GN=Mcm8 PE=3 SV=1 208 726 1.0E-75
sp|Q2KHI9|MCM9_MOUSE DNA helicase MCM9 OS=Mus musculus GN=Mcm9 PE=1 SV=2 216 706 8.0E-75
sp|F4IFF3|MCM9_ARATH Probable DNA helicase MCM9 OS=Arabidopsis thaliana GN=MCM9 PE=3 SV=1 202 724 2.0E-74
sp|Q9UJA3|MCM8_HUMAN DNA helicase MCM8 OS=Homo sapiens GN=MCM8 PE=1 SV=2 208 726 2.0E-74
sp|Q9CWV1|MCM8_MOUSE DNA helicase MCM8 OS=Mus musculus GN=Mcm8 PE=1 SV=3 208 726 4.0E-74
sp|F1N2W9|MCM9_BOVIN DNA helicase MCM9 OS=Bos taurus GN=MCM9 PE=3 SV=2 216 706 9.0E-74
sp|F1M5F3|MCM9_RAT DNA helicase MCM9 OS=Rattus norvegicus GN=Mcm9 PE=3 SV=2 216 706 1.0E-73
sp|Q9NXL9|MCM9_HUMAN DNA helicase MCM9 OS=Homo sapiens GN=MCM9 PE=1 SV=4 216 706 2.0E-73
sp|F6RIX4|MCM9_XENTR DNA helicase MCM9 OS=Xenopus tropicalis GN=mcm9 PE=3 SV=1 212 706 2.0E-72
sp|E1BPX4|MCM8_BOVIN DNA helicase MCM8 OS=Bos taurus GN=MCM8 PE=3 SV=2 208 726 3.0E-72
sp|Q6NRM6|MCM9_XENLA DNA helicase MCM9 OS=Xenopus laevis GN=mcm9 PE=1 SV=1 212 706 3.0E-71
sp|F1QDI9|MCM9_DANRE DNA helicase MCM9 OS=Danio rerio GN=mcm9 PE=3 SV=2 216 687 7.0E-71
sp|I0IUP4|MCM9_CHICK DNA helicase MCM9 OS=Gallus gallus GN=MCM9 PE=1 SV=2 216 706 1.0E-68
sp|Q58884|Y1489_METJA Uncharacterized MCM-type protein MJ1489 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1489 PE=3 SV=1 194 748 6.0E-59
sp|Q58371|Y961_METJA Uncharacterized MCM-type protein MJ0961 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0961 PE=3 SV=1 356 704 7.0E-47
sp|Q57809|Y363_METJA Uncharacterized MCM-type protein MJ0363 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0363 PE=3 SV=1 206 737 3.0E-43
sp|Q9VF30|MCMR_DROME DNA replication licensing factor REC OS=Drosophila melanogaster GN=rec PE=1 SV=2 201 601 3.0E-28
sp|Q60275|Y3513_METJA Uncharacterized MCM-type protein MJECL13 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJECL13 PE=3 SV=1 409 703 2.0E-16
sp|Q6F353|MCM6_ORYSJ DNA replication licensing factor MCM6 OS=Oryza sativa subsp. japonica GN=Os05g0235800 PE=3 SV=1 208 340 3.0E-12
sp|B8AZX3|MCM6_ORYSI DNA replication licensing factor MCM6 OS=Oryza sativa subsp. indica GN=MCM6 PE=3 SV=1 208 340 7.0E-12
sp|Q86B14|MCM6_DICDI DNA replication licensing factor mcm6 OS=Dictyostelium discoideum GN=mcm6 PE=3 SV=1 208 340 2.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0005524 ATP binding Yes
GO:0006270 DNA replication initiation Yes
GO:0016887 ATPase activity Yes
GO:0044238 primary metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0006259 DNA metabolic process No
GO:0003676 nucleic acid binding No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0044260 cellular macromolecule metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0008144 drug binding No
GO:0003674 molecular_function No
GO:0016462 pyrophosphatase activity No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0016787 hydrolase activity No
GO:0090304 nucleic acid metabolic process No
GO:0017076 purine nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0030554 adenyl nucleotide binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9657
MALREFKAPVNYETQQKAFEVFLKDFKTSPEHTIATAMGDITIDDDDLSDDDDLMDEDEESRQRRQQEKERSRTP
RHKYSEMLQELADRKINEIMIELDDLFAWEGEMEENLKLVDCIEMNAKHYVETISRAVDSVMPPPSVDVSFKDDV
LDVLMARREARNRELDEAAERDPTAELDKFPAELTRRYTLVFKPRSGTTDRPAKALAVRQVRGEHIGKLITVRCI
ATRVSDVKPIVQVSAYTCDRCGCEIFQPVSDKQYGPLTVCPSEDCKKNQSKGQLNPSTRASKFLPFQEVKVQEMA
EQVPIGQIPRSLTVLCHGSLVRKVNPGDVVDISGIFLPTPYTGFKAIKAGLLTDTYLEAHHIRQHKKAYSEMIVD
PRLVRRIDKYRQTGQVYELLANSIAPEIYGHLDVKKALLLLLIGGVSKEMGDGMKIRGDINICLMGDPGVAKSQL
LKYISKVAPRGVYTSGRGSSGVGLTAAVMRDPVTDEMILEGGALVLADNGICCIDEFDKMDDNDRTAIHEVMEQQ
TISISKAGISTTLNARTSILAAANPVYGRYNPRISPVENINLPAALLSRFDVLFLLLDTPSRDTDEQLAKHVAFV
HMHSRHPDLGTDNVVFSPHEVRSYVAQARTYRPVVPESVSDYMIKTYVRLRDQQKRAEQRGKQFTHTTPRTLLGV
VRLAQALARLRFSSQVSQDDVDEALRLVEASKESLNAEMDTSRRGLNASSRIYNLVKALADSGACRADDAADDDD
DDELGVELSMRKVKERVIAKGFTEDQWLSTLEEYTTLDIWQTAGHGSRLVFVTANNEDRDDDVDE*
Coding >Hirsu2|9657
ATGGCGCTCCGCGAGTTCAAGGCCCCCGTCAATTATGAGACGCAACAAAAGGCCTTTGAAGTCTTCCTGAAGGAT
TTCAAAACGTCTCCCGAGCATACCATTGCCACGGCCATGGGCGACATCACGATTGACGATGACGATCTCAGTGAC
GACGACGACTTGATGGACGAGGACGAGGAGTCCAGACAGCGTCGTCAACAGGAAAAGGAGCGCAGCCGAACCCCG
CGACACAAGTACAGCGAGATGCTTCAAGAACTGGCAGATCGTAAGATCAACGAGATCATGATTGAACTGGACGAT
TTGTTCGCCTGGGAGGGAGAAATGGAAGAGAATCTGAAGCTTGTCGACTGTATAGAGATGAACGCCAAGCACTAC
GTGGAGACGATATCCAGAGCCGTGGACAGCGTCATGCCACCGCCGAGCGTGGACGTCAGTTTCAAAGACGACGTT
CTCGACGTCTTGATGGCACGGCGAGAGGCTCGCAACAGAGAGCTTGACGAGGCTGCCGAGCGGGATCCTACGGCC
GAGCTGGACAAGTTTCCCGCCGAGCTGACGAGACGCTACACCCTCGTCTTCAAGCCTCGATCCGGCACCACTGAT
CGACCTGCCAAGGCACTCGCCGTCCGACAAGTTCGCGGCGAGCACATCGGCAAGCTCATCACGGTCCGATGCATC
GCAACGAGGGTGTCGGACGTCAAGCCCATTGTCCAAGTCAGCGCCTACACGTGCGACCGCTGTGGCTGCGAGATC
TTCCAGCCCGTCAGCGACAAGCAGTACGGCCCCCTGACCGTATGCCCATCGGAGGACTGCAAGAAGAACCAGTCC
AAGGGGCAGCTGAATCCGTCGACGCGAGCATCCAAGTTCCTGCCCTTCCAAGAAGTCAAGGTGCAGGAAATGGCG
GAGCAGGTCCCCATCGGCCAGATCCCCCGTTCGCTGACCGTCCTATGCCACGGCAGCCTGGTTCGCAAGGTCAAT
CCCGGCGACGTGGTGGACATATCGGGCATTTTCCTGCCCACGCCCTACACTGGCTTCAAGGCCATCAAGGCCGGC
CTGCTGACGGACACGTATCTCGAGGCCCACCACATCCGCCAACACAAGAAGGCCTACAGCGAGATGATTGTCGAC
CCGCGGCTGGTCCGGCGGATCGACAAGTACAGGCAGACGGGACAGGTCTACGAGCTACTCGCCAACTCGATCGCC
CCCGAGATTTACGGCCACCTCGACGTCAAGAAGGCCCTTCTGCTCCTGCTAATCGGAGGTGTCAGCAAGGAAATG
GGCGACGGCATGAAGATCCGCGGCGACATTAACATCTGCCTGATGGGCGACCCCGGTGTTGCCAAATCTCAGCTG
CTCAAGTACATCTCCAAGGTCGCGCCGCGCGGCGTCTACACATCCGGCCGGGGGAGCAGCGGCGTCGGCTTGACC
GCCGCCGTCATGCGCGATCCCGTCACCGACGAGATGATCCTCGAGGGCGGCGCGCTTGTGCTGGCCGACAACGGC
ATCTGCTGCATCGACGAGTTCGACAAGATGGACGACAACGACCGCACTGCCATCCACGAGGTCATGGAGCAGCAG
ACCATCTCCATCTCCAAGGCAGGCATCTCTACCACCCTCAACGCCCGCACCTCTATCCTGGCCGCGGCCAACCCG
GTATACGGGCGGTACAACCCCCGCATCTCGCCAGTCGAGAACATCAATCTGCCCGCCGCCCTGCTGTCCCGGTTC
GACGTCCTTTTCCTCCTCCTCGATACCCCCTCGCGCGACACGGACGAGCAGCTGGCCAAGCACGTGGCCTTCGTC
CACATGCACAGCCGCCATCCCGACCTCGGCACCGACAACGTCGTCTTTAGCCCGCACGAGGTGCGGTCCTACGTG
GCGCAGGCCCGCACGTACCGGCCGGTCGTGCCGGAGTCCGTCTCCGACTACATGATCAAGACGTACGTCCGCCTG
CGGGACCAGCAGAAGCGCGCCGAGCAGAGGGGCAAGCAGTTCACGCACACGACGCCGCGTACCCTCCTGGGCGTC
GTCCGCCTGGCGCAGGCCCTGGCCCGGCTCCGCTTCAGCAGCCAGGTCTCGCAAGATGACGTGGACGAGGCGCTG
CGGCTGGTCGAGGCCAGCAAGGAAAGCCTCAACGCCGAGATGGACACGTCGCGCCGCGGCCTCAACGCCAGCAGC
AGGATCTACAATCTGGTCAAGGCCCTGGCCGATTCGGGCGCCTGCCGCGCAGACGACGCGGCCGACGACGACGAC
GACGACGAGCTCGGCGTCGAGCTGAGCATGCGCAAGGTCAAGGAGCGCGTCATTGCCAAGGGCTTCACCGAGGAC
CAGTGGCTCAGCACTTTGGAGGAGTACACGACCCTAGATATCTGGCAAACGGCTGGGCACGGCTCGCGACTGGTC
TTCGTCACGGCCAACAACGAGGACCGTGACGATGACGTTGACGAGTGA
Transcript >Hirsu2|9657
ATGGCGCTCCGCGAGTTCAAGGCCCCCGTCAATTATGAGACGCAACAAAAGGCCTTTGAAGTCTTCCTGAAGGAT
TTCAAAACGTCTCCCGAGCATACCATTGCCACGGCCATGGGCGACATCACGATTGACGATGACGATCTCAGTGAC
GACGACGACTTGATGGACGAGGACGAGGAGTCCAGACAGCGTCGTCAACAGGAAAAGGAGCGCAGCCGAACCCCG
CGACACAAGTACAGCGAGATGCTTCAAGAACTGGCAGATCGTAAGATCAACGAGATCATGATTGAACTGGACGAT
TTGTTCGCCTGGGAGGGAGAAATGGAAGAGAATCTGAAGCTTGTCGACTGTATAGAGATGAACGCCAAGCACTAC
GTGGAGACGATATCCAGAGCCGTGGACAGCGTCATGCCACCGCCGAGCGTGGACGTCAGTTTCAAAGACGACGTT
CTCGACGTCTTGATGGCACGGCGAGAGGCTCGCAACAGAGAGCTTGACGAGGCTGCCGAGCGGGATCCTACGGCC
GAGCTGGACAAGTTTCCCGCCGAGCTGACGAGACGCTACACCCTCGTCTTCAAGCCTCGATCCGGCACCACTGAT
CGACCTGCCAAGGCACTCGCCGTCCGACAAGTTCGCGGCGAGCACATCGGCAAGCTCATCACGGTCCGATGCATC
GCAACGAGGGTGTCGGACGTCAAGCCCATTGTCCAAGTCAGCGCCTACACGTGCGACCGCTGTGGCTGCGAGATC
TTCCAGCCCGTCAGCGACAAGCAGTACGGCCCCCTGACCGTATGCCCATCGGAGGACTGCAAGAAGAACCAGTCC
AAGGGGCAGCTGAATCCGTCGACGCGAGCATCCAAGTTCCTGCCCTTCCAAGAAGTCAAGGTGCAGGAAATGGCG
GAGCAGGTCCCCATCGGCCAGATCCCCCGTTCGCTGACCGTCCTATGCCACGGCAGCCTGGTTCGCAAGGTCAAT
CCCGGCGACGTGGTGGACATATCGGGCATTTTCCTGCCCACGCCCTACACTGGCTTCAAGGCCATCAAGGCCGGC
CTGCTGACGGACACGTATCTCGAGGCCCACCACATCCGCCAACACAAGAAGGCCTACAGCGAGATGATTGTCGAC
CCGCGGCTGGTCCGGCGGATCGACAAGTACAGGCAGACGGGACAGGTCTACGAGCTACTCGCCAACTCGATCGCC
CCCGAGATTTACGGCCACCTCGACGTCAAGAAGGCCCTTCTGCTCCTGCTAATCGGAGGTGTCAGCAAGGAAATG
GGCGACGGCATGAAGATCCGCGGCGACATTAACATCTGCCTGATGGGCGACCCCGGTGTTGCCAAATCTCAGCTG
CTCAAGTACATCTCCAAGGTCGCGCCGCGCGGCGTCTACACATCCGGCCGGGGGAGCAGCGGCGTCGGCTTGACC
GCCGCCGTCATGCGCGATCCCGTCACCGACGAGATGATCCTCGAGGGCGGCGCGCTTGTGCTGGCCGACAACGGC
ATCTGCTGCATCGACGAGTTCGACAAGATGGACGACAACGACCGCACTGCCATCCACGAGGTCATGGAGCAGCAG
ACCATCTCCATCTCCAAGGCAGGCATCTCTACCACCCTCAACGCCCGCACCTCTATCCTGGCCGCGGCCAACCCG
GTATACGGGCGGTACAACCCCCGCATCTCGCCAGTCGAGAACATCAATCTGCCCGCCGCCCTGCTGTCCCGGTTC
GACGTCCTTTTCCTCCTCCTCGATACCCCCTCGCGCGACACGGACGAGCAGCTGGCCAAGCACGTGGCCTTCGTC
CACATGCACAGCCGCCATCCCGACCTCGGCACCGACAACGTCGTCTTTAGCCCGCACGAGGTGCGGTCCTACGTG
GCGCAGGCCCGCACGTACCGGCCGGTCGTGCCGGAGTCCGTCTCCGACTACATGATCAAGACGTACGTCCGCCTG
CGGGACCAGCAGAAGCGCGCCGAGCAGAGGGGCAAGCAGTTCACGCACACGACGCCGCGTACCCTCCTGGGCGTC
GTCCGCCTGGCGCAGGCCCTGGCCCGGCTCCGCTTCAGCAGCCAGGTCTCGCAAGATGACGTGGACGAGGCGCTG
CGGCTGGTCGAGGCCAGCAAGGAAAGCCTCAACGCCGAGATGGACACGTCGCGCCGCGGCCTCAACGCCAGCAGC
AGGATCTACAATCTGGTCAAGGCCCTGGCCGATTCGGGCGCCTGCCGCGCAGACGACGCGGCCGACGACGACGAC
GACGACGAGCTCGGCGTCGAGCTGAGCATGCGCAAGGTCAAGGAGCGCGTCATTGCCAAGGGCTTCACCGAGGAC
CAGTGGCTCAGCACTTTGGAGGAGTACACGACCCTAGATATCTGGCAAACGGCTGGGCACGGCTCGCGACTGGTC
TTCGTCACGGCCAACAACGAGGACCGTGACGATGACGTTGACGAGTGA
Gene >Hirsu2|9657
ATGGCGCTCCGCGAGTTCAAGGCCCCCGTCAATTATGAGACGCAACAAAGTCAGTCTCACAGCCGTCCCGCCCTC
TCCCCGGCACAAAGATCTAACTAGTCGCAGAGGCCTTTGAAGTCTTCCTGAAGGATTTCAAAACGTCTCCCGAGC
ATACCATTGCCACGGCCATGGGCGACATCACGATTGACGATGACGATCTCAGTGACGACGACGACTTGATGGACG
AGGACGAGGAGTCCAGACAGCGTCGTCAACAGGAAAAGGAGCGCAGCCGAACCCCGCGACACAAGTACAGCGAGA
TGCTTCAAGAACTGGCAGATCGTAAGATCAACGAGATCATGATTGAACTGGACGATTTGTTCGCCGTGCGTTGCT
GCACCTCCATCGCCAGTCCTCCGAGCTCTGCTGACGCGACGTCCAGTGGGAGGGAGAAATGGAAGAGAATCTGAA
GCTTGTCGACTGTATAGAGATGAACGCCAAGCACTACGTGGAGACGATATCCAGAGCCGTGGACAGCGTCATGCC
ACCGCCGAGCGTGGACGTCAGGTAGGTGCTCCAGTCGTTTTCGCAAACCAAGCGACATGACACTGACCTGGGCGC
AGTTTCAAAGACGACGTTCTCGACGTCTTGATGGCACGGCGAGAGGCTCGCAACAGAGAGCTTGACGAGGCTGCC
GAGCGGGATCCTACGGCCGAGCTGGACAAGTTTCCCGCCGAGCTGACGAGACGCTACACCCTCGTCTTCAAGCCT
CGATCCGGCACCACTGATCGACCTGCCAAGGCACTCGCCGTCCGACAAGTTCGCGGCGAGCACATCGGCAAGCTC
ATCACGGTCCGATGCATCGCAACGAGGGTGTCGGACGTCAAGCCCATTGTCCAAGTCAGCGCCTACACGTGCGAC
CGCTGTGGCTGCGAGATCTTCCAGCCCGTCAGCGACAAGCAGTACGGCCCCCTGACCGTATGCCCATCGGAGGAC
TGCAAGAAGAACCAGTCCAAGGGGCAGCTGAATCCGTCGACGCGAGCATCCAAGTTCCTGCCCTTCCAAGAAGTC
AAGGTGCAGGAAATGGCGGAGCAGGTCCCCATCGGCCAGATCCCCCGTTCGCTGACCGTCCTATGCCACGGCAGC
CTGGTTCGCAAGGTCAATCCCGGCGACGTGGTGGACATATCGGGCATTTTCCTGCCCACGCCCTACACTGGCTTC
AAGGCCATCAAGGCCGGCCTGCTGACGGACACGTATCTCGAGGCCCACCACATCCGCCAACACAAGAAGGCCTAC
AGCGAGATGATTGTCGACCCGCGGCTGGTCCGGCGGATCGACAAGTACAGGCAGACGGGACAGGTCTACGAGCTA
CTCGCCAACTCGATCGCCCCCGAGATTTACGGCCACCTCGACGTCAAGAAGGCCCTTCTGCTCCTGCTAATCGGA
GGTGTCAGCAAGGAAATGGGCGACGGCATGAAGATCCGCGGCGACATTAACATCTGCCTGATGGGCGACCCCGGT
GTTGCCAAATCTCAGCTGCTCAAGTACATCTCCAAGGTCGCGCCGCGCGGCGTCTACACATCCGGCCGGGGGAGC
AGCGGCGTCGGCTTGACCGCCGCCGTCATGCGCGATCCCGTCACCGACGAGATGATCCTCGAGGGCGGCGCGCTT
GTGCTGGCCGACAACGGCATCTGCTGCATCGACGAGTTCGACAAGATGGACGACAACGACCGCACTGCCATCCAC
GAGGTCATGGAGCAGCAGACCATCTCCATCTCCAAGGCAGGCATCTCTACCACCCTCAACGCCCGCACCTCTATC
CTGGCCGCGGCCAACCCGGTATACGGGCGGTACAACCCCCGCATCTCGCCAGTCGAGAACATCAATCTGCCCGCC
GCCCTGCTGTCCCGGTTCGACGTCCTTTTCCTCCTCCTCGATACCCCCTCGCGCGACACGGACGAGCAGCTGGCC
AAGCACGTGGCCTTCGTCCACATGCACAGCCGCCATCCCGACCTCGGCACCGACAACGTCGTCTTTAGCCCGCAC
GAGGTGCGGTCCTACGTGGCGCAGGCCCGCACGTACCGGCCGGTCGTGCCGGAGTCCGTCTCCGACTACATGATC
AAGACGTACGTCCGCCTGCGGGACCAGCAGAAGCGCGCCGAGCAGAGGGGCAAGCAGTTCACGCACACGACGCCG
CGTACCCTCCTGGGCGTCGTCCGCCTGGCGCAGGCCCTGGCCCGGCTCCGCTTCAGCAGCCAGGTCTCGCAAGAT
GACGTGGACGAGGCGCTGCGGCTGGTCGAGGCCAGCAAGGAAAGCCTCAACGCCGAGATGGACACGTCGCGCCGC
GGCCTCAACGCCAGCAGCAGGATCTACAATCTGGTCAAGGCCCTGGCCGATTCGGGCGCCTGCCGCGCAGACGAC
GCGGCCGACGACGACGACGACGACGAGCTCGGCGTCGAGCTGAGCATGCGCAAGGTCAAGGAGCGCGTCATTGCC
AAGGGCTTCACCGAGGACCAGTGGCTCAGCACTTTGGAGGAGTACACGACCCTAGATGTGAGTTTTTTTTATTCG
CCTGTTGTTCCCCTTTCCTTCCTTCTCCCCCCTTGGGCCGCGGCCTCCATTTTCCACCTCTCCGTTCCCACCCCT
CCCTCCGCCCGAGCCCGCAGGCTAACAGACGACCAATTCCAGATCTGGCAAACGGCTGGGCACGGCTCGCGACTG
GTCTTCGTCACGGCCAACAACGAGGACCGTGACGATGACGTTGACGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail