Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9654
Gene name
LocationContig_716:103..2343
Strand+
Gene length (bp)2240
Transcript length (bp)2034
Coding sequence length (bp)2034
Protein length (aa) 678

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00620 RhoGAP RhoGAP domain 3.4E-29 400 542

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10164|RGA2_SCHPO Probable Rho-type GTPase-activating protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga2 PE=1 SV=1 399 567 1.0E-19
sp|P32873|BEM3_YEAST GTPase-activating protein BEM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BEM3 PE=1 SV=3 387 562 1.0E-16
sp|Q8BL80|RHG22_MOUSE Rho GTPase-activating protein 22 OS=Mus musculus GN=Arhgap22 PE=1 SV=2 369 540 4.0E-15
sp|Q74ZH7|BEM3_ASHGO GTPase-activating protein BEM3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BEM3 PE=3 SV=2 396 589 5.0E-15
sp|Q62796|RBP1_RAT RalA-binding protein 1 OS=Rattus norvegicus GN=Ralbp1 PE=1 SV=3 399 560 9.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10164|RGA2_SCHPO Probable Rho-type GTPase-activating protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga2 PE=1 SV=1 399 567 1.0E-19
sp|P32873|BEM3_YEAST GTPase-activating protein BEM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BEM3 PE=1 SV=3 387 562 1.0E-16
sp|Q8BL80|RHG22_MOUSE Rho GTPase-activating protein 22 OS=Mus musculus GN=Arhgap22 PE=1 SV=2 369 540 4.0E-15
sp|Q74ZH7|BEM3_ASHGO GTPase-activating protein BEM3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BEM3 PE=3 SV=2 396 589 5.0E-15
sp|Q62796|RBP1_RAT RalA-binding protein 1 OS=Rattus norvegicus GN=Ralbp1 PE=1 SV=3 399 560 9.0E-15
sp|Q15311|RBP1_HUMAN RalA-binding protein 1 OS=Homo sapiens GN=RALBP1 PE=1 SV=3 399 544 9.0E-15
sp|Q9HF75|BEM2_ASHGO GTPase-activating protein BEM2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BEM2 PE=3 SV=1 399 538 5.0E-14
sp|Q54FG5|GACJJ_DICDI Rho GTPase-activating protein gacJJ OS=Dictyostelium discoideum GN=gacJJ PE=3 SV=1 399 542 7.0E-14
sp|Q62172|RBP1_MOUSE RalA-binding protein 1 OS=Mus musculus GN=Ralbp1 PE=1 SV=4 399 560 9.0E-14
sp|Q7Z5H3|RHG22_HUMAN Rho GTPase-activating protein 22 OS=Homo sapiens GN=ARHGAP22 PE=1 SV=1 369 540 2.0E-13
sp|O43295|SRGP3_HUMAN SLIT-ROBO Rho GTPase-activating protein 3 OS=Homo sapiens GN=SRGAP3 PE=1 SV=3 399 542 4.0E-13
sp|A2RUV4|RHG21_XENTR Rho GTPase-activating protein 21 OS=Xenopus tropicalis GN=arhgap21 PE=2 SV=1 413 542 5.0E-13
sp|Q69ZH9|RHG23_MOUSE Rho GTPase-activating protein 23 OS=Mus musculus GN=Arhgap23 PE=1 SV=2 387 542 8.0E-13
sp|Q812A2|SRGP3_MOUSE SLIT-ROBO Rho GTPase-activating protein 3 OS=Mus musculus GN=Srgap3 PE=1 SV=1 399 542 1.0E-12
sp|O94988|FA13A_HUMAN Protein FAM13A OS=Homo sapiens GN=FAM13A PE=1 SV=2 369 575 1.0E-12
sp|Q71M21|RH21B_XENLA Rho GTPase-activating protein 21-B OS=Xenopus laevis GN=arhgap21-b PE=2 SV=1 413 542 2.0E-12
sp|Q9P227|RHG23_HUMAN Rho GTPase-activating protein 23 OS=Homo sapiens GN=ARHGAP23 PE=1 SV=2 387 542 2.0E-12
sp|Q5T5U3|RHG21_HUMAN Rho GTPase-activating protein 21 OS=Homo sapiens GN=ARHGAP21 PE=1 SV=1 395 582 4.0E-12
sp|Q6DFG0|RH21A_XENLA Rho GTPase-activating protein 21-A OS=Xenopus laevis GN=arhgap21-a PE=2 SV=1 398 542 5.0E-12
sp|Q5VT97|SYDE2_HUMAN Rho GTPase-activating protein SYDE2 OS=Homo sapiens GN=SYDE2 PE=1 SV=2 384 542 7.0E-12
sp|Q6DFV3|RHG21_MOUSE Rho GTPase-activating protein 21 OS=Mus musculus GN=Arhgap21 PE=1 SV=1 395 582 9.0E-12
sp|Q54TH9|GACY_DICDI Rho GTPase-activating protein gacY OS=Dictyostelium discoideum GN=gacY PE=3 SV=1 399 545 1.0E-11
sp|Q55DW9|GACZ_DICDI Rho GTPase-activating protein gacZ OS=Dictyostelium discoideum GN=gacZ PE=3 SV=1 398 560 1.0E-11
sp|Q811P8|RHG32_MOUSE Rho GTPase-activating protein 32 OS=Mus musculus GN=Arhgap32 PE=1 SV=2 397 549 2.0E-11
sp|A7KAX9|RHG32_HUMAN Rho GTPase-activating protein 32 OS=Homo sapiens GN=ARHGAP32 PE=1 SV=1 397 549 3.0E-11
sp|P83509|RHG35_CANLF Rho GTPase-activating protein 35 OS=Canis lupus familiaris GN=ARHGAP35 PE=2 SV=1 399 542 4.0E-11
sp|P81128|RHG35_RAT Rho GTPase-activating protein 35 OS=Rattus norvegicus GN=Arhgap35 PE=1 SV=2 399 542 4.0E-11
sp|Q91YM2|RHG35_MOUSE Rho GTPase-activating protein 35 OS=Mus musculus GN=Arhgap35 PE=1 SV=3 399 542 5.0E-11
sp|Q9NRY4|RHG35_HUMAN Rho GTPase-activating protein 35 OS=Homo sapiens GN=ARHGAP35 PE=1 SV=3 399 542 5.0E-11
sp|Q91Z69|SRGP1_MOUSE SLIT-ROBO Rho GTPase-activating protein 1 OS=Mus musculus GN=Srgap1 PE=1 SV=2 399 542 6.0E-11
sp|Q54G18|GACW_DICDI Rho GTPase-activating protein gacW OS=Dictyostelium discoideum GN=gacW PE=3 SV=1 399 560 7.0E-11
sp|Q7Z6B7|SRGP1_HUMAN SLIT-ROBO Rho GTPase-activating protein 1 OS=Homo sapiens GN=SRGAP1 PE=1 SV=1 399 542 1.0E-10
sp|P38339|RGD1_YEAST RHO GTPase-activating protein RGD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGD1 PE=1 SV=1 399 542 1.0E-10
sp|Q6TLK4|RHG27_RAT Rho GTPase-activating protein 27 OS=Rattus norvegicus GN=Arhgap27 PE=1 SV=1 399 542 1.0E-10
sp|B2RTY4|MYO9A_HUMAN Unconventional myosin-IXa OS=Homo sapiens GN=MYO9A PE=1 SV=2 376 542 1.0E-10
sp|Q9Z1N3|MYO9A_RAT Unconventional myosin-IXa OS=Rattus norvegicus GN=Myo9a PE=1 SV=1 376 542 2.0E-10
sp|Q8N264|RHG24_HUMAN Rho GTPase-activating protein 24 OS=Homo sapiens GN=ARHGAP24 PE=1 SV=2 400 540 2.0E-10
sp|Q8C4V1|RHG24_MOUSE Rho GTPase-activating protein 24 OS=Mus musculus GN=Arhgap24 PE=1 SV=2 400 540 2.0E-10
sp|P39960|BEM2_YEAST GTPase-activating protein BEM2/IPL2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BEM2 PE=1 SV=1 388 538 2.0E-10
sp|Q9PT60|RBP1A_XENLA RalA-binding protein 1-A OS=Xenopus laevis GN=ralbp1-a PE=1 SV=3 370 564 3.0E-10
sp|A2AB59|RHG27_MOUSE Rho GTPase-activating protein 27 OS=Mus musculus GN=Arhgap27 PE=1 SV=1 399 542 3.0E-10
sp|Q5U2Z7|RHG24_RAT Rho GTPase-activating protein 24 OS=Rattus norvegicus GN=Arhgap24 PE=1 SV=2 400 540 3.0E-10
sp|Q8C170|MYO9A_MOUSE Unconventional myosin-IXa OS=Mus musculus GN=Myo9a PE=1 SV=2 376 542 3.0E-10
sp|Q6ZUM4|RHG27_HUMAN Rho GTPase-activating protein 27 OS=Homo sapiens GN=ARHGAP27 PE=1 SV=3 399 542 6.0E-10
sp|Q53QZ3|RHG15_HUMAN Rho GTPase-activating protein 15 OS=Homo sapiens GN=ARHGAP15 PE=1 SV=2 399 542 7.0E-10
sp|Q6GPD0|RHG32_XENLA Rho GTPase-activating protein 32 OS=Xenopus laevis GN=arhgap32 PE=2 SV=1 417 549 7.0E-10
sp|Q640N3|RHG30_MOUSE Rho GTPase-activating protein 30 OS=Mus musculus GN=Arhgap30 PE=1 SV=3 417 542 8.0E-10
sp|P34288|PAC1_CAEEL GTPase-activating protein pac-1 OS=Caenorhabditis elegans GN=pac-1 PE=1 SV=4 399 542 8.0E-10
sp|Q9V9S7|SYDE_DROME Rho GTPase-activating protein 100F OS=Drosophila melanogaster GN=RhoGAP100F PE=1 SV=2 399 556 1.0E-09
sp|Q13017|RHG05_HUMAN Rho GTPase-activating protein 5 OS=Homo sapiens GN=ARHGAP5 PE=1 SV=2 399 542 1.0E-09
sp|Q7Z6I6|RHG30_HUMAN Rho GTPase-activating protein 30 OS=Homo sapiens GN=ARHGAP30 PE=1 SV=3 417 542 2.0E-09
sp|A4IF90|RHG15_BOVIN Rho GTPase-activating protein 15 OS=Bos taurus GN=ARHGAP15 PE=2 SV=1 399 542 2.0E-09
sp|Q8C0D4|RHG12_MOUSE Rho GTPase-activating protein 12 OS=Mus musculus GN=Arhgap12 PE=1 SV=2 399 542 4.0E-09
sp|P97393|RHG05_MOUSE Rho GTPase-activating protein 5 OS=Mus musculus GN=Arhgap5 PE=1 SV=2 399 542 4.0E-09
sp|Q2M1Z3|RHG31_HUMAN Rho GTPase-activating protein 31 OS=Homo sapiens GN=ARHGAP31 PE=1 SV=2 408 542 6.0E-09
sp|Q9BE31|RHG12_MACFA Rho GTPase-activating protein 12 OS=Macaca fascicularis GN=ARHGAP12 PE=2 SV=1 399 542 6.0E-09
sp|A6X8Z5|RHG31_MOUSE Rho GTPase-activating protein 31 OS=Mus musculus GN=Arhgap31 PE=1 SV=1 408 571 8.0E-09
sp|Q8IWW6|RHG12_HUMAN Rho GTPase-activating protein 12 OS=Homo sapiens GN=ARHGAP12 PE=1 SV=1 399 542 8.0E-09
sp|Q811M1|RHG15_MOUSE Rho GTPase-activating protein 15 OS=Mus musculus GN=Arhgap15 PE=1 SV=1 399 542 8.0E-09
sp|Q55DK5|MGP3_DICDI Mental retardation GTPase activating protein homolog 3 OS=Dictyostelium discoideum GN=mgp3 PE=3 SV=1 418 542 2.0E-08
sp|O94466|RGA7_SCHPO Probable Rho-GTPase-activating protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga7 PE=1 SV=1 414 542 3.0E-08
sp|Q55CK2|MGP2_DICDI Mental retardation GTPase activating protein homolog 2 OS=Dictyostelium discoideum GN=mgp2 PE=3 SV=1 413 582 7.0E-08
sp|Q54C77|Y3184_DICDI Probable inactive serine/threonine-protein kinase DDB_G0293184 OS=Dictyostelium discoideum GN=DDB_G0293184 PE=3 SV=1 399 553 7.0E-08
sp|Q559A0|GACU_DICDI Rho GTPase-activating protein gacU OS=Dictyostelium discoideum GN=gacU PE=3 SV=1 399 542 8.0E-08
sp|Q55GP8|GACO_DICDI Rho GTPase-activating protein gacO OS=Dictyostelium discoideum GN=gacO PE=3 SV=1 384 542 1.0E-07
sp|Q5ZMM3|RHG15_CHICK Rho GTPase-activating protein 15 OS=Gallus gallus GN=ARHGAP15 PE=2 SV=1 399 542 1.0E-07
sp|O74360|RGA4_SCHPO Probable Rho-type GTPase-activating protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga4 PE=1 SV=2 395 545 2.0E-07
sp|O14014|RGA3_SCHPO Probable Rho-type GTPase-activating protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga3 PE=1 SV=1 382 545 2.0E-07
sp|Q80YF9|RHG33_MOUSE Rho GTPase-activating protein 33 OS=Mus musculus GN=Arhgap33 PE=1 SV=1 417 542 3.0E-07
sp|O14559|RHG33_HUMAN Rho GTPase-activating protein 33 OS=Homo sapiens GN=ARHGAP33 PE=1 SV=2 417 542 4.0E-07
sp|P98171|RHG04_HUMAN Rho GTPase-activating protein 4 OS=Homo sapiens GN=ARHGAP4 PE=1 SV=2 399 542 5.0E-07
sp|Q86I31|GACFF_DICDI Rho GTPase-activating protein gacFF OS=Dictyostelium discoideum GN=gacFF PE=2 SV=1 384 543 6.0E-07
sp|Q9VX32|RG190_DROME Rho GTPase-activating protein 190 OS=Drosophila melanogaster GN=RhoGAPp190 PE=1 SV=2 399 542 1.0E-06
sp|Q9VIS1|CDGAP_DROME GTPase-activating protein CdGAPr OS=Drosophila melanogaster GN=CdGAPr PE=1 SV=2 399 542 1.0E-06
sp|Q9DBZ9|SYDE1_MOUSE Rho GTPase-activating protein SYDE1 OS=Mus musculus GN=Syde1 PE=1 SV=1 374 542 1.0E-06
sp|Q9CXP4|RHG08_MOUSE Rho GTPase-activating protein 8 OS=Mus musculus GN=Arhgap8 PE=2 SV=3 388 538 3.0E-06
sp|Q07960|RHG01_HUMAN Rho GTPase-activating protein 1 OS=Homo sapiens GN=ARHGAP1 PE=1 SV=1 399 542 3.0E-06
sp|Q4LDD4|ARAP1_MOUSE Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1 OS=Mus musculus GN=Arap1 PE=1 SV=2 399 542 5.0E-06
sp|Q96P48|ARAP1_HUMAN Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens GN=ARAP1 PE=1 SV=3 399 542 6.0E-06
sp|Q5FWK3|RHG01_MOUSE Rho GTPase-activating protein 1 OS=Mus musculus GN=Arhgap1 PE=1 SV=1 399 542 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0007165 signal transduction Yes
GO:0050789 regulation of biological process No
GO:0009987 cellular process No
GO:0065007 biological regulation No
GO:0008150 biological_process No
GO:0050794 regulation of cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9654
MGRKPTPQPLMLAESTSTLDRSADGEPACTETTAPASSPAGSRSPVSQHSSPFSSRFGPKRPHKGRPALQPADDA
DQQDHHYQHRPQPARGDSDATPLSSALEASPAANPPHANGPHGVTESKKHIKTGFFHFNKSSKGSNQLFISSHQP
QPQHNHHHDSREQLTSSGSEGVAIPKRQGSPYAHDSLQKPSNSFPSRSELSLSSAGGDHEAIATPSPGKKAKPKP
FGRLGRTRSTHESKEHDSPKASPAALPAASSRTDLYDSAPLRTAPVAQDRSFRDMMSSTTRNRSEDRAPSRDASS
VKDHPRDRDQRLQPSSLRENGGSTFLSGLRSSSTKAADMISKGLFGKSPRSGGTPEKESTVDDEHYALRVINLPL
VEQTRLTRISKRLENSRDKTEFWMPAFPWRAIDYLNYKGCDVEGLYRVPGSGPQVKKWQRKFDEHYDVNLFDEDS
LYDINIIGSMLKAWLRELPDELFPKEAQDRISRECAGSIEVPQMLVDELSNLSPFNYYLLFAITCHLSLLLAHSD
KNKMDFRNLCICFQPCMKIDAFCFKFLVCDWRDCWKGCKNEAKYIEEEYTLFDQPPPRGLSEPQQPAKHDQADER
QGSSPDSTKKSTGSNGRRKARSKKHRHHVSESNASVRSNDSSISTNLSSHSDRNATTEGTRDMRPLSPIKPLSPL
GF*
Coding >Hirsu2|9654
ATGGGACGCAAGCCCACGCCGCAGCCGCTCATGCTGGCGGAGTCGACCAGCACCCTAGACCGCTCTGCCGATGGC
GAGCCGGCCTGTACTGAAACGACGGCACCGGCCTCTTCGCCCGCCGGCTCCAGATCACCCGTCTCGCAGCACTCG
TCACCCTTTTCCTCCAGGTTCGGCCCTAAGCGCCCACACAAAGGCAGACCAGCCTTGCAGCCTGCAGACGATGCC
GACCAGCAAGACCACCACTACCAACACCGACCCCAGCCTGCCCGCGGCGACTCGGACGCCACGCCTCTCTCCTCC
GCCTTGGAAGCTTCCCCGGCCGCCAATCCCCCGCACGCCAACGGCCCGCATGGCGTAACAGAGTCCAAGAAGCAC
ATCAAGACGGGCTTCTTCCACTTCAACAAATCTTCCAAGGGCTCCAATCAGCTCTTCATTTCGTCCCATCAACCG
CAGCCGCAACACAACCACCACCACGACTCGCGCGAACAGTTGACTTCGTCGGGCAGCGAGGGGGTCGCAATCCCA
AAACGTCAAGGCTCCCCCTACGCGCATGACTCCCTCCAGAAGCCTTCAAATTCGTTCCCGTCGCGGTCCGAACTA
TCGCTGTCGTCCGCCGGCGGCGATCACGAAGCCATCGCGACGCCGTCTCCGGGAAAGAAGGCCAAGCCGAAGCCG
TTTGGTCGCCTTGGCCGCACAAGATCGACGCACGAAAGCAAGGAACACGACAGCCCCAAGGCCTCGCCTGCGGCG
CTCCCGGCCGCCTCCAGCAGGACCGACCTCTACGACTCGGCACCTCTGAGAACGGCCCCGGTCGCCCAGGATCGG
TCGTTCCGGGACATGATGAGCTCGACGACGAGAAACCGATCGGAAGACCGAGCCCCGAGCCGAGATGCCTCTTCA
GTAAAGGACCACCCCCGCGACAGGGACCAGCGACTTCAGCCGTCCTCGTTGAGAGAAAACGGCGGGTCGACCTTC
CTCAGCGGGCTGCGTAGCTCGTCGACGAAGGCTGCCGACATGATCAGCAAGGGGCTGTTCGGAAAGAGCCCACGA
AGTGGCGGCACGCCGGAGAAGGAGTCGACGGTCGACGACGAGCACTACGCCCTCAGAGTCATCAACTTGCCCTTG
GTGGAGCAGACACGTCTGACCCGCATCTCGAAGCGGCTGGAGAATTCGCGGGACAAGACAGAGTTCTGGATGCCC
GCCTTCCCTTGGCGGGCCATCGACTATCTGAACTACAAGGGCTGTGACGTGGAAGGACTGTACCGCGTCCCTGGA
AGCGGGCCGCAGGTGAAGAAGTGGCAGCGCAAGTTCGATGAGCACTACGACGTCAACCTGTTCGATGAAGATAGC
CTATACGACATCAACATCATCGGCTCGATGCTCAAGGCATGGCTACGAGAACTGCCCGACGAGCTGTTCCCCAAA
GAGGCCCAGGACCGGATTTCCCGAGAGTGCGCCGGCTCGATCGAAGTGCCGCAGATGCTCGTCGACGAGCTCTCC
AACCTGTCGCCATTCAACTACTACCTCCTCTTTGCCATTACCTGCCACCTCAGCCTGCTCCTCGCCCATTCCGAC
AAGAACAAGATGGACTTTCGAAACCTGTGCATCTGCTTCCAGCCCTGCATGAAAATCGACGCCTTCTGCTTCAAG
TTTCTGGTCTGCGACTGGAGGGACTGCTGGAAGGGCTGTAAGAACGAGGCCAAGTACATCGAGGAGGAGTACACG
CTCTTCGACCAGCCTCCCCCTCGAGGCCTGTCCGAGCCCCAACAGCCCGCGAAACACGACCAGGCCGACGAACGC
CAGGGGTCGTCTCCGGACAGCACCAAAAAGTCTACGGGCAGCAACGGCCGGCGCAAGGCACGATCTAAGAAGCAC
CGTCACCACGTCTCGGAGTCAAACGCCAGCGTCCGCTCCAATGACTCGTCCATATCGACGAATCTGAGCTCGCAC
AGCGATCGCAACGCGACGACCGAGGGCACCCGGGACATGCGACCTCTGTCGCCCATCAAACCGTTGTCACCACTC
GGATTCTAG
Transcript >Hirsu2|9654
ATGGGACGCAAGCCCACGCCGCAGCCGCTCATGCTGGCGGAGTCGACCAGCACCCTAGACCGCTCTGCCGATGGC
GAGCCGGCCTGTACTGAAACGACGGCACCGGCCTCTTCGCCCGCCGGCTCCAGATCACCCGTCTCGCAGCACTCG
TCACCCTTTTCCTCCAGGTTCGGCCCTAAGCGCCCACACAAAGGCAGACCAGCCTTGCAGCCTGCAGACGATGCC
GACCAGCAAGACCACCACTACCAACACCGACCCCAGCCTGCCCGCGGCGACTCGGACGCCACGCCTCTCTCCTCC
GCCTTGGAAGCTTCCCCGGCCGCCAATCCCCCGCACGCCAACGGCCCGCATGGCGTAACAGAGTCCAAGAAGCAC
ATCAAGACGGGCTTCTTCCACTTCAACAAATCTTCCAAGGGCTCCAATCAGCTCTTCATTTCGTCCCATCAACCG
CAGCCGCAACACAACCACCACCACGACTCGCGCGAACAGTTGACTTCGTCGGGCAGCGAGGGGGTCGCAATCCCA
AAACGTCAAGGCTCCCCCTACGCGCATGACTCCCTCCAGAAGCCTTCAAATTCGTTCCCGTCGCGGTCCGAACTA
TCGCTGTCGTCCGCCGGCGGCGATCACGAAGCCATCGCGACGCCGTCTCCGGGAAAGAAGGCCAAGCCGAAGCCG
TTTGGTCGCCTTGGCCGCACAAGATCGACGCACGAAAGCAAGGAACACGACAGCCCCAAGGCCTCGCCTGCGGCG
CTCCCGGCCGCCTCCAGCAGGACCGACCTCTACGACTCGGCACCTCTGAGAACGGCCCCGGTCGCCCAGGATCGG
TCGTTCCGGGACATGATGAGCTCGACGACGAGAAACCGATCGGAAGACCGAGCCCCGAGCCGAGATGCCTCTTCA
GTAAAGGACCACCCCCGCGACAGGGACCAGCGACTTCAGCCGTCCTCGTTGAGAGAAAACGGCGGGTCGACCTTC
CTCAGCGGGCTGCGTAGCTCGTCGACGAAGGCTGCCGACATGATCAGCAAGGGGCTGTTCGGAAAGAGCCCACGA
AGTGGCGGCACGCCGGAGAAGGAGTCGACGGTCGACGACGAGCACTACGCCCTCAGAGTCATCAACTTGCCCTTG
GTGGAGCAGACACGTCTGACCCGCATCTCGAAGCGGCTGGAGAATTCGCGGGACAAGACAGAGTTCTGGATGCCC
GCCTTCCCTTGGCGGGCCATCGACTATCTGAACTACAAGGGCTGTGACGTGGAAGGACTGTACCGCGTCCCTGGA
AGCGGGCCGCAGGTGAAGAAGTGGCAGCGCAAGTTCGATGAGCACTACGACGTCAACCTGTTCGATGAAGATAGC
CTATACGACATCAACATCATCGGCTCGATGCTCAAGGCATGGCTACGAGAACTGCCCGACGAGCTGTTCCCCAAA
GAGGCCCAGGACCGGATTTCCCGAGAGTGCGCCGGCTCGATCGAAGTGCCGCAGATGCTCGTCGACGAGCTCTCC
AACCTGTCGCCATTCAACTACTACCTCCTCTTTGCCATTACCTGCCACCTCAGCCTGCTCCTCGCCCATTCCGAC
AAGAACAAGATGGACTTTCGAAACCTGTGCATCTGCTTCCAGCCCTGCATGAAAATCGACGCCTTCTGCTTCAAG
TTTCTGGTCTGCGACTGGAGGGACTGCTGGAAGGGCTGTAAGAACGAGGCCAAGTACATCGAGGAGGAGTACACG
CTCTTCGACCAGCCTCCCCCTCGAGGCCTGTCCGAGCCCCAACAGCCCGCGAAACACGACCAGGCCGACGAACGC
CAGGGGTCGTCTCCGGACAGCACCAAAAAGTCTACGGGCAGCAACGGCCGGCGCAAGGCACGATCTAAGAAGCAC
CGTCACCACGTCTCGGAGTCAAACGCCAGCGTCCGCTCCAATGACTCGTCCATATCGACGAATCTGAGCTCGCAC
AGCGATCGCAACGCGACGACCGAGGGCACCCGGGACATGCGACCTCTGTCGCCCATCAAACCGTTGTCACCACTC
GGATTCTAG
Gene >Hirsu2|9654
ATGGGACGCAAGCCCACGCCGCAGCCGCTCATGCTGGCGGAGTCGACCAGCACCCTAGACCGCTCTGCCGATGGC
GAGCCGGCCTGTACTGAAACGACGGCACCGGCCTCTTCGCCCGCCGGCTCCAGATCACCCGTCTCGCAGCACTCG
TCACCCTTTTCCTCCAGGTTCGGCCCTAAGCGCCCACACAAAGGCAGACCAGCCTTGCAGCCTGCAGACGATGCC
GACCAGCAAGACCACCACTACCAACACCGACCCCAGCCTGCCCGCGGCGACTCGGACGCCACGCCTCTCTCCTCC
GCCTTGGAAGCTTCCCCGGCCGCCAATCCCCCGCACGCCAACGGCCCGCATGGCGTAACAGAGTCCAAGAAGCAC
ATCAAGACGGGCTTCTTCCACTTCAACAAATCTTCCAAGGGCTCCAATCAGCTCTTCATTTCGTCCCATCAACCG
CAGCCGCAACACAACCACCACCACGACTCGCGCGAACAGTTGACTTCGTCGGGCAGCGAGGGGGTCGCAATCCCA
AAACGTCAAGGTACGCCCGTGCCATGTATAGCCCTTGTCTATGCCGCTACGGACCGCCCACCGCTCCCCTGCCCG
CTTCGACGCCCCGAACTGCTTCTGCCGCTGCCATCGTGCTGCCCACCCACCCTCTCCGCTTGCTTCTGACGTCTT
CTCCTTAGGCTCCCCCTACGCGCATGACTCCCTCCAGAAGCCTTCAAATTCGTTCCCGTCGCGGTCCGAACTATC
GCTGTCGTCCGCCGGCGGCGATCACGAAGCCATCGCGACGCCGTCTCCGGGAAAGAAGGCCAAGCCGAAGCCGTT
TGGTCGCCTTGGCCGCACAAGATCGACGCACGAAAGCAAGGAACACGACAGCCCCAAGGCCTCGCCTGCGGCGCT
CCCGGCCGCCTCCAGCAGGACCGACCTCTACGACTCGGCACCTCTGAGAACGGCCCCGGTCGCCCAGGATCGGTC
GTTCCGGGACATGATGAGCTCGACGACGAGAAACCGATCGGAAGACCGAGCCCCGAGCCGAGATGCCTCTTCAGT
AAAGGACCACCCCCGCGACAGGGACCAGCGACTTCAGCCGTCCTCGTTGAGAGAAAACGGCGGGTCGACCTTCCT
CAGCGGGCTGCGTAGCTCGTCGACGAAGGCTGCCGACATGATCAGCAAGGGGCTGTTCGGAAAGAGCCCACGAAG
TGGCGGCACGCCGGAGAAGGAGTCGACGGTCGACGACGAGCACTACGCCCTCAGAGTCATCAACTTGCCCTTGGT
GGAGCAGACACGTCTGACCCGCATCTCGAAGCGGCTGGAGAATTCGCGGGACAAGACAGAGTTCTGGATGCCCGC
CTTCCCTTGGCGGGCCATCGACTATCTGAACTACAAGGGCTGTGACGTGGAAGGACTGTACCGCGTCCCTGGAAG
CGGGCCGCAGGTGAAGAAGTGGCAGCGCAAGTTCGATGAGCGTACGTGCCCTGCCGTTCGGTGCTACGAGGTGAC
GGCTGTCGACTGACCCGCTTGCAGACTACGACGTCAACCTGTTCGATGAAGATAGCCTATACGACATCAACATCA
TCGGCTCGATGCTCAAGGCATGGCTACGAGAACTGCCCGACGAGCTGTTCCCCAAAGAGGCCCAGGACCGGATTT
CCCGAGAGTGCGCCGGCTCGATCGAAGTGCCGCAGATGCTCGTCGACGAGCTCTCCAACCTGTCGCCATTCAACT
ACTACCTCCTCTTTGCCATTACCTGCCACCTCAGCCTGCTCCTCGCCCATTCCGACAAGAACAAGATGGACTTTC
GAAACCTGTGCATCTGCTTCCAGCCCTGCATGAAAATCGACGCCTTCTGCTTCAAGTTTCTGGTCTGCGACTGGA
GGGACTGCTGGAAGGGCTGTAAGAACGAGGCCAAGTACATCGAGGAGGAGTACACGCTCTTCGACCAGCCTCCCC
CTCGAGGCCTGTCCGAGCCCCAACAGCCCGCGAAACACGACCAGGCCGACGAACGCCAGGGGTCGTCTCCGGACA
GCACCAAAAAGTCTACGGGCAGCAACGGCCGGCGCAAGGCACGATCTAAGAAGCACCGTCACCACGTCTCGGAGT
CAAACGCCAGCGTCCGCTCCAATGACTCGTCCATATCGACGAATCTGAGCTCGCACAGCGATCGCAACGCGACGA
CCGAGGGCACCCGGGACATGCGACCTCTGTCGCCCATCAAACCGTTGTCACCACTCGGATTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail