Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9650
Gene name
LocationContig_715:3977..4442
Strand+
Gene length (bp)465
Transcript length (bp)414
Coding sequence length (bp)414
Protein length (aa) 138

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.0673 0.0782 0.9844 0.0421 0.0498 0.0067 0.0644 0.0622 0.0566 0.004

SignalP

SignalP signal predicted Location Score
Yes 1 - 15 0.997246

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup10981
Change Orthofinder run
Species Protein ID
Ophiocordyceps subramaniannii Hirsu2|9650 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9650
MKFTHVSLFLAVTAASPIEKDKLSSRSYASEEVDASQSYNLNVDARRSHDKRQNPVGLDAIPNFLGALGEVLGVN
PNQDPNQDTEQTQDTEHVADTENIQDVENVLDVQNPENSMITINSQNSQNSPNTPNRPNGAT*
Coding >Hirsu2|9650
ATGAAGTTTACGCACGTTTCTCTCTTCCTCGCTGTAACGGCGGCCTCGCCTATCGAGAAGGACAAGCTTAGCTCG
AGATCATATGCCTCGGAGGAGGTGGATGCATCGCAGAGCTATAACCTTAACGTCGACGCCCGTCGCAGCCACGAT
AAGCGCCAGAACCCAGTGGGCCTTGACGCAATACCCAATTTCCTTGGCGCCCTCGGGGAGGTACTAGGCGTGAAC
CCCAACCAAGACCCCAACCAGGACACCGAGCAAACCCAAGACACGGAGCATGTCGCGGATACCGAGAATATCCAG
GATGTAGAGAATGTCCTAGATGTCCAGAACCCCGAGAATAGTATGATTACCATCAACAGCCAGAATAGCCAGAAT
AGCCCAAATACCCCGAACCGCCCGAATGGCGCGACCTAA
Transcript >Hirsu2|9650
ATGAAGTTTACGCACGTTTCTCTCTTCCTCGCTGTAACGGCGGCCTCGCCTATCGAGAAGGACAAGCTTAGCTCG
AGATCATATGCCTCGGAGGAGGTGGATGCATCGCAGAGCTATAACCTTAACGTCGACGCCCGTCGCAGCCACGAT
AAGCGCCAGAACCCAGTGGGCCTTGACGCAATACCCAATTTCCTTGGCGCCCTCGGGGAGGTACTAGGCGTGAAC
CCCAACCAAGACCCCAACCAGGACACCGAGCAAACCCAAGACACGGAGCATGTCGCGGATACCGAGAATATCCAG
GATGTAGAGAATGTCCTAGATGTCCAGAACCCCGAGAATAGTATGATTACCATCAACAGCCAGAATAGCCAGAAT
AGCCCAAATACCCCGAACCGCCCGAATGGCGCGACCTAA
Gene >Hirsu2|9650
ATGAAGTTTACGCACGTTTCTCTCTTCCTCGCTGTAACGGCGGCCTCGCCTATCGAGGTACGCATGGCCGTACCC
CCTCTCTCGCTCTCCATACTGAACTGTTCATAGAAGGACAAGCTTAGCTCGAGATCATATGCCTCGGAGGAGGTG
GATGCATCGCAGAGCTATAACCTTAACGTCGACGCCCGTCGCAGCCACGATAAGCGCCAGAACCCAGTGGGCCTT
GACGCAATACCCAATTTCCTTGGCGCCCTCGGGGAGGTACTAGGCGTGAACCCCAACCAAGACCCCAACCAGGAC
ACCGAGCAAACCCAAGACACGGAGCATGTCGCGGATACCGAGAATATCCAGGATGTAGAGAATGTCCTAGATGTC
CAGAACCCCGAGAATAGTATGATTACCATCAACAGCCAGAATAGCCAGAATAGCCCAAATACCCCGAACCGCCCG
AATGGCGCGACCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail