Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|965
Gene name
LocationContig_12:67182..69518
Strand+
Gene length (bp)2336
Transcript length (bp)1908
Coding sequence length (bp)1908
Protein length (aa) 636

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 2.6E-69 291 546
PF07714 Pkinase_Tyr Protein tyrosine kinase 1.5E-32 292 532
PF00433 Pkinase_C Protein kinase C terminal domain 2.2E-13 567 608

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7J8|GAD8_SCHPO Serine/threonine-protein kinase gad8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gad8 PE=1 SV=1 1 611 0.0E+00
sp|P12688|YPK1_YEAST Serine/threonine-protein kinase YPK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK1 PE=1 SV=2 19 608 8.0E-173
sp|P18961|YPK2_YEAST Serine/threonine-protein kinase YPK2/YKR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK2 PE=1 SV=1 44 608 5.0E-171
sp|P54644|KRAC_DICDI RAC family serine/threonine-protein kinase homolog OS=Dictyostelium discoideum GN=pkbA PE=1 SV=1 262 608 5.0E-123
sp|P28178|PK2_DICDI Protein kinase 2 OS=Dictyostelium discoideum GN=pkgB PE=1 SV=2 289 608 6.0E-116
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7J8|GAD8_SCHPO Serine/threonine-protein kinase gad8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gad8 PE=1 SV=1 1 611 0.0E+00
sp|P12688|YPK1_YEAST Serine/threonine-protein kinase YPK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK1 PE=1 SV=2 19 608 8.0E-173
sp|P18961|YPK2_YEAST Serine/threonine-protein kinase YPK2/YKR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK2 PE=1 SV=1 44 608 5.0E-171
sp|P54644|KRAC_DICDI RAC family serine/threonine-protein kinase homolog OS=Dictyostelium discoideum GN=pkbA PE=1 SV=1 262 608 5.0E-123
sp|P28178|PK2_DICDI Protein kinase 2 OS=Dictyostelium discoideum GN=pkgB PE=1 SV=2 289 608 6.0E-116
sp|P11792|SCH9_YEAST Serine/threonine-protein kinase SCH9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCH9 PE=1 SV=3 269 608 2.0E-111
sp|Q5AHG6|SCH9_CANAL Serine/threonine-protein kinase SCH9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SCH9 PE=3 SV=1 172 608 9.0E-109
sp|Q2PJ68|SGK1_CAEEL Serine/threonine-protein kinase sgk-1 OS=Caenorhabditis elegans GN=sgk-1 PE=1 SV=1 290 608 1.0E-106
sp|A8XNJ6|SGK1_CAEBR Serine/threonine-protein kinase sgk-1 OS=Caenorhabditis briggsae GN=sgk-1 PE=3 SV=3 290 608 1.0E-105
sp|Q8MYF1|Y2070_DICDI Probable serine/threonine-protein kinase DDB_G0277449 OS=Dictyostelium discoideum GN=DDB_G0277449 PE=3 SV=1 283 610 9.0E-105
sp|Q6U1I9|SGK1_CHICK Serine/threonine-protein kinase Sgk1 OS=Gallus gallus GN=SGK1 PE=2 SV=1 287 612 2.0E-104
sp|Q6GPN6|SGK1A_XENLA Serine/threonine-protein kinase Sgk1-A OS=Xenopus laevis GN=sgk1-a PE=2 SV=1 287 612 2.0E-104
sp|Q9HBY8|SGK2_HUMAN Serine/threonine-protein kinase Sgk2 OS=Homo sapiens GN=SGK2 PE=1 SV=1 290 608 2.0E-104
sp|Q5BKK4|SGK1_XENTR Serine/threonine-protein kinase Sgk1 OS=Xenopus tropicalis GN=sgk1 PE=2 SV=1 287 612 4.0E-104
sp|O00141|SGK1_HUMAN Serine/threonine-protein kinase Sgk1 OS=Homo sapiens GN=SGK1 PE=1 SV=2 287 611 6.0E-104
sp|Q9WVC6|SGK1_MOUSE Serine/threonine-protein kinase Sgk1 OS=Mus musculus GN=Sgk1 PE=1 SV=1 287 612 8.0E-104
sp|Q6GLY8|SGK1B_XENLA Serine/threonine-protein kinase Sgk1-B OS=Xenopus laevis GN=sgk1-b PE=2 SV=1 287 612 9.0E-104
sp|Q4R633|SGK1_MACFA Serine/threonine-protein kinase Sgk1 OS=Macaca fascicularis GN=SGK1 PE=2 SV=1 287 611 1.0E-103
sp|A7MB74|SGK1_BOVIN Serine/threonine-protein kinase Sgk1 OS=Bos taurus GN=SGK1 PE=2 SV=1 287 612 1.0E-103
sp|Q8R4U9|SGK2_RAT Serine/threonine-protein kinase Sgk2 OS=Rattus norvegicus GN=Sgk2 PE=1 SV=2 290 608 3.0E-103
sp|Q06226|SGK1_RAT Serine/threonine-protein kinase Sgk1 OS=Rattus norvegicus GN=Sgk1 PE=1 SV=1 287 612 4.0E-103
sp|Q9XT18|SGK1_RABIT Serine/threonine-protein kinase Sgk1 OS=Oryctolagus cuniculus GN=SGK1 PE=2 SV=1 287 612 6.0E-103
sp|P50530|SCK1_SCHPO Serine/threonine-protein kinase sck1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sck1 PE=1 SV=2 270 608 2.0E-102
sp|Q9QZS5|SGK2_MOUSE Serine/threonine-protein kinase Sgk2 OS=Mus musculus GN=Sgk2 PE=1 SV=1 290 608 1.0E-101
sp|Q7ZTW4|SGK1_DANRE Serine/threonine-protein kinase Sgk1 OS=Danio rerio GN=sgk1 PE=2 SV=1 287 608 2.0E-101
sp|Q5Q0U5|SGK1_FUNHE Serine/threonine-protein kinase Sgk1 OS=Fundulus heteroclitus GN=sgk1 PE=2 SV=1 287 608 1.0E-100
sp|Q8R4V0|SGK3_RAT Serine/threonine-protein kinase Sgk3 OS=Rattus norvegicus GN=Sgk3 PE=1 SV=2 287 615 7.0E-100
sp|Q7ZX15|AKT2A_XENLA RAC-beta serine/threonine-protein kinase A OS=Xenopus laevis GN=akt2-a PE=2 SV=1 285 612 1.0E-99
sp|Q60823|AKT2_MOUSE RAC-beta serine/threonine-protein kinase OS=Mus musculus GN=Akt2 PE=1 SV=1 226 612 2.0E-99
sp|Q9ERE3|SGK3_MOUSE Serine/threonine-protein kinase Sgk3 OS=Mus musculus GN=Sgk3 PE=1 SV=1 287 615 2.0E-99
sp|P67999|KS6B1_RAT Ribosomal protein S6 kinase beta-1 OS=Rattus norvegicus GN=Rps6kb1 PE=1 SV=1 268 611 4.0E-99
sp|P67998|KS6B1_RABIT Ribosomal protein S6 kinase beta-1 OS=Oryctolagus cuniculus GN=RPS6KB1 PE=2 SV=1 268 611 4.0E-99
sp|Q6TJY3|KS6B1_BOVIN Ribosomal protein S6 kinase beta-1 OS=Bos taurus GN=RPS6KB1 PE=2 SV=1 268 611 4.0E-99
sp|Q8BSK8|KS6B1_MOUSE Ribosomal protein S6 kinase beta-1 OS=Mus musculus GN=Rps6kb1 PE=1 SV=2 268 611 4.0E-99
sp|P23443|KS6B1_HUMAN Ribosomal protein S6 kinase beta-1 OS=Homo sapiens GN=RPS6KB1 PE=1 SV=2 268 611 4.0E-99
sp|P31751|AKT2_HUMAN RAC-beta serine/threonine-protein kinase OS=Homo sapiens GN=AKT2 PE=1 SV=2 226 612 4.0E-99
sp|Q5R7A7|SGK3_PONAB Serine/threonine-protein kinase Sgk3 OS=Pongo abelii GN=SGK3 PE=2 SV=1 290 615 6.0E-99
sp|Q96BR1|SGK3_HUMAN Serine/threonine-protein kinase Sgk3 OS=Homo sapiens GN=SGK3 PE=1 SV=1 290 615 6.0E-99
sp|Q54IF2|Y0670_DICDI Probable serine/threonine-protein kinase DDB_G0288795 OS=Dictyostelium discoideum GN=DDB_G0288795 PE=2 SV=1 262 611 4.0E-98
sp|P47197|AKT2_RAT RAC-beta serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt2 PE=1 SV=1 226 612 7.0E-98
sp|Q6IP76|AKT2B_XENLA RAC-beta serine/threonine-protein kinase B OS=Xenopus laevis GN=akt2-b PE=2 SV=1 285 612 2.0E-97
sp|Q8INB9|AKT1_DROME RAC serine/threonine-protein kinase OS=Drosophila melanogaster GN=Akt1 PE=1 SV=3 285 632 2.0E-97
sp|Q39030|KPK2_ARATH Serine/threonine-protein kinase AtPK2/AtPK19 OS=Arabidopsis thaliana GN=ATPK2 PE=1 SV=2 280 611 3.0E-97
sp|P13678|KPC3_DROME Protein kinase C OS=Drosophila melanogaster GN=Pkc98E PE=2 SV=1 280 614 1.0E-96
sp|Q9Z1M4|KS6B2_MOUSE Ribosomal protein S6 kinase beta-2 OS=Mus musculus GN=Rps6kb2 PE=1 SV=1 291 611 2.0E-95
sp|Q01314|AKT1_BOVIN RAC-alpha serine/threonine-protein kinase OS=Bos taurus GN=AKT1 PE=1 SV=2 263 609 2.0E-95
sp|Q9NAH6|KS6B_CAEEL Ribosomal protein S6 kinase beta OS=Caenorhabditis elegans GN=rsks-1 PE=1 SV=2 289 611 4.0E-95
sp|Q04759|KPCT_HUMAN Protein kinase C theta type OS=Homo sapiens GN=PRKCQ PE=1 SV=3 285 611 2.0E-94
sp|P09215|KPCD_RAT Protein kinase C delta type OS=Rattus norvegicus GN=Prkcd PE=1 SV=1 283 611 3.0E-94
sp|Q10364|SCK2_SCHPO Serine/threonine-protein kinase sck2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sck2 PE=3 SV=1 289 608 4.0E-94
sp|P31750|AKT1_MOUSE RAC-alpha serine/threonine-protein kinase OS=Mus musculus GN=Akt1 PE=1 SV=2 226 609 5.0E-94
sp|P31748|AKT_MLVAT AKT kinase-transforming protein OS=AKT8 murine leukemia virus GN=V-AKT PE=1 SV=1 226 609 8.0E-94
sp|P31749|AKT1_HUMAN RAC-alpha serine/threonine-protein kinase OS=Homo sapiens GN=AKT1 PE=1 SV=2 263 609 1.0E-93
sp|Q17941|AKT1_CAEEL Serine/threonine-protein kinase akt-1 OS=Caenorhabditis elegans GN=akt-1 PE=1 SV=2 221 615 1.0E-93
sp|Q9UBS0|KS6B2_HUMAN Ribosomal protein S6 kinase beta-2 OS=Homo sapiens GN=RPS6KB2 PE=1 SV=2 291 611 1.0E-93
sp|Q9Y243|AKT3_HUMAN RAC-gamma serine/threonine-protein kinase OS=Homo sapiens GN=AKT3 PE=1 SV=1 226 609 2.0E-93
sp|Q98TY9|AKT1_XENLA RAC-alpha serine/threonine-protein kinase OS=Xenopus laevis GN=akt1 PE=2 SV=1 225 609 2.0E-93
sp|Q02111|KPCT_MOUSE Protein kinase C theta type OS=Mus musculus GN=Prkcq PE=1 SV=1 285 611 2.0E-93
sp|P47196|AKT1_RAT RAC-alpha serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt1 PE=1 SV=1 263 609 3.0E-93
sp|Q9WTQ0|KPCT_RAT Protein kinase C theta type OS=Rattus norvegicus GN=Prkcq PE=1 SV=2 285 611 1.0E-92
sp|Q9WUA6|AKT3_MOUSE RAC-gamma serine/threonine-protein kinase OS=Mus musculus GN=Akt3 PE=1 SV=1 226 584 2.0E-92
sp|P28867|KPCD_MOUSE Protein kinase C delta type OS=Mus musculus GN=Prkcd PE=1 SV=3 259 611 3.0E-92
sp|Q63484|AKT3_RAT RAC-gamma serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt3 PE=2 SV=2 226 584 6.0E-92
sp|P42818|KPK1_ARATH Serine/threonine-protein kinase AtPK1/AtPK6 OS=Arabidopsis thaliana GN=ATPK1 PE=1 SV=1 283 611 1.0E-91
sp|P34885|KPC1B_CAEEL Protein kinase C-like 1B OS=Caenorhabditis elegans GN=pkc-1 PE=2 SV=2 284 611 7.0E-91
sp|P23298|KPCL_MOUSE Protein kinase C eta type OS=Mus musculus GN=Prkch PE=1 SV=2 283 611 1.0E-90
sp|Q64617|KPCL_RAT Protein kinase C eta type OS=Rattus norvegicus GN=Prkch PE=1 SV=1 283 611 1.0E-90
sp|P24723|KPCL_HUMAN Protein kinase C eta type OS=Homo sapiens GN=PRKCH PE=1 SV=4 283 611 2.0E-90
sp|Q9XTG7|AKT2_CAEEL Serine/threonine-protein kinase akt-2 OS=Caenorhabditis elegans GN=akt-2 PE=1 SV=1 282 582 3.0E-90
sp|Q16975|KPC2_APLCA Calcium-independent protein kinase C OS=Aplysia californica GN=PRKC2 PE=1 SV=1 286 614 7.0E-90
sp|Q05655|KPCD_HUMAN Protein kinase C delta type OS=Homo sapiens GN=PRKCD PE=1 SV=2 252 611 6.0E-89
sp|Q5PU49|KPCD_CANLF Protein kinase C delta type OS=Canis lupus familiaris GN=PRKCD PE=2 SV=1 285 611 7.0E-89
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 245 608 2.0E-88
sp|P10830|KPCE_RABIT Protein kinase C epsilon type OS=Oryctolagus cuniculus GN=PRKCE PE=2 SV=1 253 608 3.0E-88
sp|P16054|KPCE_MOUSE Protein kinase C epsilon type OS=Mus musculus GN=Prkce PE=1 SV=1 282 608 7.0E-88
sp|Q02156|KPCE_HUMAN Protein kinase C epsilon type OS=Homo sapiens GN=PRKCE PE=1 SV=1 277 608 7.0E-88
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 291 608 7.0E-88
sp|Q9UK32|KS6A6_HUMAN Ribosomal protein S6 kinase alpha-6 OS=Homo sapiens GN=RPS6KA6 PE=1 SV=1 291 608 9.0E-88
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 291 608 2.0E-87
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 291 613 2.0E-87
sp|Q7TPS0|KS6A6_MOUSE Ribosomal protein S6 kinase alpha-6 OS=Mus musculus GN=Rps6ka6 PE=1 SV=2 291 608 6.0E-87
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 243 608 2.0E-86
sp|P09216|KPCE_RAT Protein kinase C epsilon type OS=Rattus norvegicus GN=Prkce PE=1 SV=1 277 608 2.0E-86
sp|P34102|PK3_DICDI Protein kinase 3 OS=Dictyostelium discoideum GN=pkgC PE=3 SV=2 285 569 3.0E-86
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 290 625 5.0E-86
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 291 608 7.0E-86
sp|P05383|KAPCB_PIG cAMP-dependent protein kinase catalytic subunit beta OS=Sus scrofa GN=PRKACB PE=1 SV=3 288 577 2.0E-85
sp|P05986|KAPC_YEAST cAMP-dependent protein kinase type 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK3 PE=1 SV=2 276 577 3.0E-85
sp|A1Z9X0|APKC_DROME Atypical protein kinase C OS=Drosophila melanogaster GN=aPKC PE=1 SV=1 288 612 4.0E-85
sp|Q5R4K9|KPCI_PONAB Protein kinase C iota type OS=Pongo abelii GN=PRKCI PE=2 SV=2 283 612 7.0E-85
sp|P41743|KPCI_HUMAN Protein kinase C iota type OS=Homo sapiens GN=PRKCI PE=1 SV=2 283 612 8.0E-85
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 291 608 8.0E-85
sp|P22694|KAPCB_HUMAN cAMP-dependent protein kinase catalytic subunit beta OS=Homo sapiens GN=PRKACB PE=1 SV=2 288 577 1.0E-84
sp|F1M7Y5|KPCI_RAT Protein kinase C iota type OS=Rattus norvegicus GN=Prkci PE=1 SV=1 266 612 1.0E-84
sp|P10666|KS6AB_XENLA Ribosomal protein S6 kinase 2 beta OS=Xenopus laevis PE=2 SV=1 278 625 1.0E-84
sp|P05131|KAPCB_BOVIN cAMP-dependent protein kinase catalytic subunit beta OS=Bos taurus GN=PRKACB PE=1 SV=2 288 577 1.0E-84
sp|Q62074|KPCI_MOUSE Protein kinase C iota type OS=Mus musculus GN=Prkci PE=1 SV=3 266 612 1.0E-84
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 291 608 2.0E-84
sp|P06244|KAPA_YEAST cAMP-dependent protein kinase type 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK1 PE=1 SV=3 267 577 4.0E-84
sp|P68182|KAPCB_RAT cAMP-dependent protein kinase catalytic subunit beta OS=Rattus norvegicus GN=Prkacb PE=1 SV=2 288 577 5.0E-84
sp|P68181|KAPCB_MOUSE cAMP-dependent protein kinase catalytic subunit beta OS=Mus musculus GN=Prkacb PE=1 SV=2 288 577 5.0E-84
sp|P68180|KAPCB_CRIGR cAMP-dependent protein kinase catalytic subunit beta OS=Cricetulus griseus GN=PRKACB PE=2 SV=2 288 577 5.0E-84
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 291 608 6.0E-84
sp|P17612|KAPCA_HUMAN cAMP-dependent protein kinase catalytic subunit alpha OS=Homo sapiens GN=PRKACA PE=1 SV=2 288 577 2.0E-83
sp|P68403|KPCB_RAT Protein kinase C beta type OS=Rattus norvegicus GN=Prkcb PE=1 SV=3 285 611 2.0E-83
sp|P68404|KPCB_MOUSE Protein kinase C beta type OS=Mus musculus GN=Prkcb PE=1 SV=4 285 611 2.0E-83
sp|P05771|KPCB_HUMAN Protein kinase C beta type OS=Homo sapiens GN=PRKCB PE=1 SV=4 285 611 3.0E-83
sp|P05126|KPCB_BOVIN Protein kinase C beta type OS=Bos taurus GN=PRKCB PE=2 SV=4 285 611 3.0E-83
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 285 611 3.0E-83
sp|P05772|KPCB_RABIT Protein kinase C beta type OS=Oryctolagus cuniculus GN=PRKCB PE=2 SV=3 285 611 3.0E-83
sp|O75676|KS6A4_HUMAN Ribosomal protein S6 kinase alpha-4 OS=Homo sapiens GN=RPS6KA4 PE=1 SV=1 285 611 5.0E-83
sp|P25321|KAPCA_CRIGR cAMP-dependent protein kinase catalytic subunit alpha OS=Cricetulus griseus GN=PRKACA PE=1 SV=2 287 577 7.0E-83
sp|Q5F3L1|KS6A5_CHICK Ribosomal protein S6 kinase alpha-5 OS=Gallus gallus GN=RPS6KA5 PE=2 SV=1 283 611 7.0E-83
sp|P05132|KAPCA_MOUSE cAMP-dependent protein kinase catalytic subunit alpha OS=Mus musculus GN=Prkaca PE=1 SV=3 287 577 8.0E-83
sp|Q8MJ44|KAPCA_CANLF cAMP-dependent protein kinase catalytic subunit alpha OS=Canis lupus familiaris GN=PRKACA PE=1 SV=3 288 577 1.0E-82
sp|Q9MZD9|KAPCA_SHEEP cAMP-dependent protein kinase catalytic subunit alpha OS=Ovis aries GN=PRKACA PE=1 SV=3 288 577 1.0E-82
sp|P00517|KAPCA_BOVIN cAMP-dependent protein kinase catalytic subunit alpha OS=Bos taurus GN=PRKACA PE=1 SV=3 288 577 2.0E-82
sp|P27791|KAPCA_RAT cAMP-dependent protein kinase catalytic subunit alpha OS=Rattus norvegicus GN=Prkaca PE=1 SV=2 287 577 2.0E-82
sp|P36887|KAPCA_PIG cAMP-dependent protein kinase catalytic subunit alpha OS=Sus scrofa GN=PRKACA PE=1 SV=4 288 577 3.0E-82
sp|Q02956|KPCZ_MOUSE Protein kinase C zeta type OS=Mus musculus GN=Prkcz PE=1 SV=2 275 612 3.0E-82
sp|P83099|KPC4_DROME Putative protein kinase C delta type homolog OS=Drosophila melanogaster GN=Pkcdelta PE=2 SV=3 282 611 4.0E-82
sp|Q9Z2B9|KS6A4_MOUSE Ribosomal protein S6 kinase alpha-4 OS=Mus musculus GN=Rps6ka4 PE=1 SV=2 285 611 4.0E-82
sp|P09217|KPCZ_RAT Protein kinase C zeta type OS=Rattus norvegicus GN=Prkcz PE=1 SV=2 275 612 5.0E-82
sp|P34722|KPC1_CAEEL Protein kinase C-like 1 OS=Caenorhabditis elegans GN=tpa-1 PE=1 SV=2 266 611 5.0E-82
sp|P34099|KAPC_DICDI cAMP-dependent protein kinase catalytic subunit OS=Dictyostelium discoideum GN=pkaC PE=1 SV=2 287 591 6.0E-82
sp|Q90XF2|KPCI_DANRE Protein kinase C iota type OS=Danio rerio GN=prkci PE=2 SV=2 286 612 6.0E-82
sp|O75582|KS6A5_HUMAN Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens GN=RPS6KA5 PE=1 SV=1 283 625 7.0E-82
sp|Q16974|KPC1_APLCA Calcium-dependent protein kinase C OS=Aplysia californica GN=PRKC1 PE=1 SV=2 286 611 7.0E-82
sp|P36583|PCK2_SCHPO Protein kinase C-like 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pck2 PE=1 SV=2 282 609 1.0E-81
sp|Q05513|KPCZ_HUMAN Protein kinase C zeta type OS=Homo sapiens GN=PRKCZ PE=1 SV=4 275 612 2.0E-81
sp|Q8C050|KS6A5_MOUSE Ribosomal protein S6 kinase alpha-5 OS=Mus musculus GN=Rps6ka5 PE=1 SV=2 283 625 3.0E-81
sp|P10102|KPCA_RABIT Protein kinase C alpha type OS=Oryctolagus cuniculus GN=PRKCA PE=2 SV=3 285 611 5.0E-81
sp|P05696|KPCA_RAT Protein kinase C alpha type OS=Rattus norvegicus GN=Prkca PE=1 SV=3 285 611 5.0E-81
sp|P17252|KPCA_HUMAN Protein kinase C alpha type OS=Homo sapiens GN=PRKCA PE=1 SV=4 285 611 7.0E-81
sp|Q00078|KPC1_ASPNG Protein kinase C-like OS=Aspergillus niger GN=pkcA PE=3 SV=1 285 613 7.0E-81
sp|P87253|KPC1_NEUCR Protein kinase C-like OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU06544 PE=3 SV=2 285 609 8.0E-81
sp|O19111|KPCZ_RABIT Protein kinase C zeta type OS=Oryctolagus cuniculus GN=PRKCZ PE=2 SV=1 275 612 1.0E-80
sp|P04409|KPCA_BOVIN Protein kinase C alpha type OS=Bos taurus GN=PRKCA PE=1 SV=3 285 611 1.0E-80
sp|O42632|KPC1_COCHE Protein kinase C-like OS=Cochliobolus heterostrophus GN=PKC1 PE=3 SV=1 285 613 1.0E-80
sp|P12370|KAPC_DROME cAMP-dependent protein kinase catalytic subunit OS=Drosophila melanogaster GN=Pka-C1 PE=1 SV=3 288 591 2.0E-80
sp|P05130|KPC1_DROME Protein kinase C, brain isozyme OS=Drosophila melanogaster GN=Pkc53E PE=2 SV=2 278 611 2.0E-80
sp|Q99014|KPC1_HYPJE Protein kinase C-like OS=Hypocrea jecorina GN=pkc1 PE=3 SV=1 283 609 2.0E-80
sp|Q5R4K3|KS6A5_PONAB Ribosomal protein S6 kinase alpha-5 OS=Pongo abelii GN=RPS6KA5 PE=2 SV=1 283 625 3.0E-80
sp|Q25378|KPC1_LYTPI Protein kinase C OS=Lytechinus pictus GN=PKC1 PE=2 SV=1 284 608 6.0E-80
sp|P20444|KPCA_MOUSE Protein kinase C alpha type OS=Mus musculus GN=Prkca PE=1 SV=3 285 611 9.0E-80
sp|P51817|PRKX_HUMAN cAMP-dependent protein kinase catalytic subunit PRKX OS=Homo sapiens GN=PRKX PE=1 SV=1 288 577 1.0E-79
sp|Q7SY24|KPCB_DANRE Protein kinase C beta type OS=Danio rerio GN=prkcbb PE=2 SV=1 285 611 1.0E-79
sp|P16912|KDC2_DROME Protein kinase DC2 OS=Drosophila melanogaster GN=Pka-C3 PE=2 SV=2 279 577 3.0E-79
sp|P06245|KAPB_YEAST cAMP-dependent protein kinase type 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK2 PE=1 SV=2 284 577 8.0E-79
sp|A8KBH6|KPCB_XENTR Protein kinase C beta type OS=Xenopus tropicalis GN=prkcb PE=2 SV=1 276 608 1.0E-78
sp|P21137|KAPC1_CAEEL cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis elegans GN=kin-1 PE=1 SV=3 288 561 1.0E-78
sp|P36582|PCK1_SCHPO Protein kinase C-like 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pck1 PE=3 SV=2 282 607 4.0E-78
sp|Q19266|KPC3_CAEEL Protein kinase C-like 3 OS=Caenorhabditis elegans GN=pkc-3 PE=1 SV=1 286 612 1.0E-77
sp|A8WUG4|KPC3_CAEBR Protein kinase C-like 3 OS=Caenorhabditis briggsae GN=pkc-3 PE=3 SV=1 286 612 4.0E-77
sp|A8XW88|KAPC1_CAEBR cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis briggsae GN=kin-1 PE=1 SV=1 288 561 5.0E-77
sp|Q922R0|PRKX_MOUSE cAMP-dependent protein kinase catalytic subunit PRKX OS=Mus musculus GN=Prkx PE=1 SV=1 288 606 6.0E-77
sp|P22612|KAPCG_HUMAN cAMP-dependent protein kinase catalytic subunit gamma OS=Homo sapiens GN=PRKACG PE=1 SV=3 289 577 7.0E-77
sp|Q7LZQ8|KPCB_XENLA Protein kinase C beta type OS=Xenopus laevis GN=prkcb PE=2 SV=1 286 608 9.0E-77
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 291 608 1.0E-76
sp|P40376|KAPB_SCHPO cAMP-dependent protein kinase catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pka1 PE=1 SV=1 281 582 3.0E-76
sp|P90980|KPC2_CAEEL Protein kinase C-like 2 OS=Caenorhabditis elegans GN=pkc-2 PE=2 SV=2 286 612 3.0E-76
sp|Q9V3I5|JIL1_DROME Chromosomal serine/threonine-protein kinase JIL-1 OS=Drosophila melanogaster GN=JIL-1 PE=1 SV=1 286 611 3.0E-76
sp|Q12706|PSK1_SCHPO Serine/threonine-protein kinase psk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psk1 PE=3 SV=1 283 608 1.0E-75
sp|P43057|KPC1_CANAX Protein kinase C-like 1 OS=Candida albicans GN=PKC1 PE=3 SV=1 282 608 1.0E-75
sp|Q7JP68|KAPC2_CAEEL cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis elegans GN=F47F2.1 PE=1 SV=1 288 603 9.0E-75
sp|P05128|KPCG_BOVIN Protein kinase C gamma type (Fragment) OS=Bos taurus GN=PRKCG PE=2 SV=1 284 611 2.0E-74
sp|P63319|KPCG_RAT Protein kinase C gamma type OS=Rattus norvegicus GN=Prkcg PE=1 SV=1 284 611 3.0E-74
sp|P63318|KPCG_MOUSE Protein kinase C gamma type OS=Mus musculus GN=Prkcg PE=1 SV=1 284 611 3.0E-74
sp|P24583|KPC1_YEAST Protein kinase C-like 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKC1 PE=1 SV=3 285 608 3.0E-74
sp|P10829|KPCG_RABIT Protein kinase C gamma type OS=Oryctolagus cuniculus GN=PRKCG PE=1 SV=1 284 611 4.0E-74
sp|P05129|KPCG_HUMAN Protein kinase C gamma type OS=Homo sapiens GN=PRKCG PE=1 SV=3 284 611 5.0E-74
sp|P49673|KAPC_ASCSU cAMP-dependent protein kinase catalytic subunit OS=Ascaris suum GN=CAPK PE=2 SV=1 279 577 3.0E-73
sp|Q7TSE6|ST38L_MOUSE Serine/threonine-protein kinase 38-like OS=Mus musculus GN=Stk38l PE=1 SV=2 276 577 4.0E-73
sp|Q16513|PKN2_HUMAN Serine/threonine-protein kinase N2 OS=Homo sapiens GN=PKN2 PE=1 SV=1 275 608 2.0E-72
sp|A8XJQ6|KAPC2_CAEBR cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis briggsae GN=CBG14305 PE=1 SV=2 288 603 2.0E-72
sp|Q4R4U2|KPCG_MACFA Protein kinase C gamma type OS=Macaca fascicularis GN=PRKCG PE=2 SV=1 284 611 2.0E-72
sp|Q9Y2H1|ST38L_HUMAN Serine/threonine-protein kinase 38-like OS=Homo sapiens GN=STK38L PE=1 SV=3 276 577 1.0E-71
sp|A7MBL8|PKN2_DANRE Serine/threonine-protein kinase N2 OS=Danio rerio GN=pkn2 PE=2 SV=1 271 608 2.0E-71
sp|A1A4I4|PKN1_BOVIN Serine/threonine-protein kinase N1 OS=Bos taurus GN=PKN1 PE=2 SV=1 282 608 4.0E-71
sp|Q54IH8|NDRB_DICDI Probable serine/threonine-protein kinase ndrB OS=Dictyostelium discoideum GN=ndrB PE=3 SV=1 273 631 5.0E-71
sp|Q6TGC6|CBK1_PNECA Serine/threonine-protein kinase CBK1 OS=Pneumocystis carinii GN=CBK1 PE=2 SV=1 277 610 6.0E-71
sp|Q8BYR2|LATS1_MOUSE Serine/threonine-protein kinase LATS1 OS=Mus musculus GN=Lats1 PE=1 SV=3 278 578 8.0E-71
sp|P13677|KPC2_DROME Protein kinase C, eye isozyme OS=Drosophila melanogaster GN=inaC PE=1 SV=1 286 611 8.0E-71
sp|Q9LE81|IRE_ARATH Probable serine/threonine protein kinase IRE OS=Arabidopsis thaliana GN=IRE PE=2 SV=1 285 624 1.0E-70
sp|P53739|FPK1_YEAST Flippase kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FPK1 PE=1 SV=1 289 604 1.0E-70
sp|Q63433|PKN1_RAT Serine/threonine-protein kinase N1 OS=Rattus norvegicus GN=Pkn1 PE=1 SV=2 282 585 4.0E-70
sp|Q8BWW9|PKN2_MOUSE Serine/threonine-protein kinase N2 OS=Mus musculus GN=Pkn2 PE=1 SV=3 285 608 4.0E-70
sp|F4HYG2|IRE3_ARATH Probable serine/threonine protein kinase IRE3 OS=Arabidopsis thaliana GN=IRE3 PE=2 SV=1 285 581 4.0E-70
sp|O08874|PKN2_RAT Serine/threonine-protein kinase N2 OS=Rattus norvegicus GN=Pkn2 PE=1 SV=2 285 608 1.0E-69
sp|Q5R8M1|STK38_PONAB Serine/threonine-protein kinase 38 OS=Pongo abelii GN=STK38 PE=2 SV=1 269 577 1.0E-69
sp|Q15208|STK38_HUMAN Serine/threonine-protein kinase 38 OS=Homo sapiens GN=STK38 PE=1 SV=1 269 577 1.0E-69
sp|P25341|KIN82_YEAST Serine/threonine-protein kinase KIN82 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN82 PE=1 SV=3 289 569 1.0E-69
sp|P70268|PKN1_MOUSE Serine/threonine-protein kinase N1 OS=Mus musculus GN=Pkn1 PE=1 SV=3 282 585 1.0E-69
sp|Q16512|PKN1_HUMAN Serine/threonine-protein kinase N1 OS=Homo sapiens GN=PKN1 PE=1 SV=2 282 585 2.0E-69
sp|O95835|LATS1_HUMAN Serine/threonine-protein kinase LATS1 OS=Homo sapiens GN=LATS1 PE=1 SV=1 278 578 2.0E-69
sp|A2VDV2|STK38_BOVIN Serine/threonine-protein kinase 38 OS=Bos taurus GN=STK38 PE=2 SV=1 269 577 3.0E-69
sp|F4HPN2|IRE4_ARATH Probable serine/threonine protein kinase IRE4 OS=Arabidopsis thaliana GN=IRE4 PE=2 SV=1 285 588 6.0E-69
sp|O42626|NRC2_NEUCR Serine/threonine-protein kinase nrc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nrc-2 PE=3 SV=1 267 576 3.0E-68
sp|O13310|ORB6_SCHPO Serine/threonine-protein kinase orb6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=orb6 PE=1 SV=1 277 610 5.0E-68
sp|Q60592|MAST2_MOUSE Microtubule-associated serine/threonine-protein kinase 2 OS=Mus musculus GN=Mast2 PE=1 SV=1 289 577 9.0E-68
sp|Q91VJ4|STK38_MOUSE Serine/threonine-protein kinase 38 OS=Mus musculus GN=Stk38 PE=1 SV=1 276 577 9.0E-68
sp|A1Z7T0|PKN_DROME Serine/threonine-protein kinase N OS=Drosophila melanogaster GN=Pkn PE=1 SV=1 283 609 2.0E-67
sp|Q5AP53|CBK1_CANAL Serine/threonine-protein kinase CBK1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CBK1 PE=1 SV=1 277 602 2.0E-67
sp|Q9Z2A0|PDPK1_MOUSE 3-phosphoinositide-dependent protein kinase 1 OS=Mus musculus GN=Pdpk1 PE=1 SV=2 285 557 4.0E-67
sp|Q8SRK8|KAPC_ENCCU Probable cAMP-dependent protein kinase catalytic subunit OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU07_0520 PE=3 SV=1 286 566 4.0E-67
sp|Q9NRM7|LATS2_HUMAN Serine/threonine-protein kinase LATS2 OS=Homo sapiens GN=LATS2 PE=1 SV=2 278 592 4.0E-67
sp|Q6P0Q8|MAST2_HUMAN Microtubule-associated serine/threonine-protein kinase 2 OS=Homo sapiens GN=MAST2 PE=1 SV=2 289 577 5.0E-67
sp|O55173|PDPK1_RAT 3-phosphoinositide-dependent protein kinase 1 OS=Rattus norvegicus GN=Pdpk1 PE=1 SV=2 285 557 1.0E-66
sp|Q6A1A2|PDPK2_HUMAN Putative 3-phosphoinositide-dependent protein kinase 2 OS=Homo sapiens GN=PDPK2P PE=5 SV=1 289 557 2.0E-66
sp|Q9NBK5|TRC_DROME Serine/threonine-protein kinase tricorner OS=Drosophila melanogaster GN=trc PE=1 SV=1 223 610 2.0E-66
sp|Q6CFS5|CBK1_YARLI Serine/threonine-protein kinase CBK1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CBK1 PE=3 SV=1 236 576 3.0E-66
sp|Q2LZZ7|TRC_DROPS Serine/threonine-protein kinase tricorner OS=Drosophila pseudoobscura pseudoobscura GN=trc PE=3 SV=1 276 610 3.0E-66
sp|Q754N7|CBK1_ASHGO Serine/threonine-protein kinase CBK1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CBK1 PE=3 SV=1 289 604 7.0E-66
sp|O15021|MAST4_HUMAN Microtubule-associated serine/threonine-protein kinase 4 OS=Homo sapiens GN=MAST4 PE=1 SV=3 285 577 8.0E-66
sp|O60307|MAST3_HUMAN Microtubule-associated serine/threonine-protein kinase 3 OS=Homo sapiens GN=MAST3 PE=1 SV=2 290 577 8.0E-66
sp|Q3U214|MAST3_MOUSE Microtubule-associated serine/threonine-protein kinase 3 OS=Mus musculus GN=Mast3 PE=1 SV=3 290 577 1.0E-65
sp|O15530|PDPK1_HUMAN 3-phosphoinositide-dependent protein kinase 1 OS=Homo sapiens GN=PDPK1 PE=1 SV=1 289 557 1.0E-65
sp|A8XJL7|SAX1_CAEBR Serine/threonine-protein kinase sax-1 OS=Caenorhabditis briggsae GN=sax-1 PE=3 SV=2 276 610 2.0E-65
sp|Q811L6|MAST4_MOUSE Microtubule-associated serine/threonine-protein kinase 4 OS=Mus musculus GN=Mast4 PE=1 SV=3 285 577 3.0E-65
sp|Q54Y26|NDRA_DICDI Probable serine/threonine-protein kinase ndrA OS=Dictyostelium discoideum GN=ndrA PE=3 SV=1 277 577 5.0E-65
sp|F4J6F6|IREH1_ARATH Probable serine/threonine protein kinase IREH1 OS=Arabidopsis thaliana GN=IREH1 PE=1 SV=1 285 581 5.0E-65
sp|P34103|PK4_DICDI Protein kinase 4 (Fragment) OS=Dictyostelium discoideum GN=pkgD PE=3 SV=2 287 567 7.0E-65
sp|Q6AX33|MAST3_XENLA Microtubule-associated serine/threonine-protein kinase 3 OS=Xenopus laevis GN=mast3 PE=2 SV=1 290 577 7.0E-65
sp|Q54L81|Y0700_DICDI Probable serine/threonine-protein kinase DDB_G0286841 OS=Dictyostelium discoideum GN=DDB_G0286841 PE=3 SV=1 288 576 1.0E-64
sp|Q6FP74|CBK1_CANGA Serine/threonine-protein kinase CBK1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CBK1 PE=3 SV=1 289 576 2.0E-64
sp|Q7TSJ6|LATS2_MOUSE Serine/threonine-protein kinase LATS2 OS=Mus musculus GN=Lats2 PE=1 SV=1 278 578 3.0E-64
sp|Q2L6W9|SAX1_CAEEL Serine/threonine-protein kinase sax-1 OS=Caenorhabditis elegans GN=sax-1 PE=2 SV=1 276 610 3.0E-64
sp|O43930|PRKY_HUMAN Putative serine/threonine-protein kinase PRKY OS=Homo sapiens GN=PRKY PE=5 SV=1 287 508 1.0E-63
sp|Q09831|PPK14_SCHPO Serine/threonine-protein kinase ppk14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk14 PE=1 SV=1 291 600 1.0E-63
sp|Q5VT25|MRCKA_HUMAN Serine/threonine-protein kinase MRCK alpha OS=Homo sapiens GN=CDC42BPA PE=1 SV=1 285 577 4.0E-63
sp|Q6DT37|MRCKG_HUMAN Serine/threonine-protein kinase MRCK gamma OS=Homo sapiens GN=CDC42BPG PE=1 SV=2 285 577 4.0E-63
sp|Q9Y2H9|MAST1_HUMAN Microtubule-associated serine/threonine-protein kinase 1 OS=Homo sapiens GN=MAST1 PE=1 SV=2 290 629 1.0E-62
sp|Q9R1L5|MAST1_MOUSE Microtubule-associated serine/threonine-protein kinase 1 OS=Mus musculus GN=Mast1 PE=1 SV=3 290 629 1.0E-62
sp|O01583|MRCK_CAEEL Serine/threonine-protein kinase mrck-1 OS=Caenorhabditis elegans GN=mrck-1 PE=2 SV=3 275 583 1.0E-62
sp|Q810W7|MAST1_RAT Microtubule-associated serine/threonine-protein kinase 1 OS=Rattus norvegicus GN=Mast1 PE=1 SV=1 290 577 2.0E-62
sp|O54874|MRCKA_RAT Serine/threonine-protein kinase MRCK alpha OS=Rattus norvegicus GN=Cdc42bpa PE=1 SV=1 285 577 2.0E-62
sp|Q3UU96|MRCKA_MOUSE Serine/threonine-protein kinase MRCK alpha OS=Mus musculus GN=Cdc42bpa PE=1 SV=2 285 577 3.0E-62
sp|P38070|YPK3_YEAST AGC kinase YPK3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK3 PE=1 SV=1 288 608 4.0E-62
sp|Q80UW5|MRCKG_MOUSE Serine/threonine-protein kinase MRCK gamma OS=Mus musculus GN=Cdc42bpg PE=1 SV=2 285 577 5.0E-62
sp|A8WVU9|ROCK_CAEBR Rho-associated protein kinase let-502 OS=Caenorhabditis briggsae GN=let-502 PE=3 SV=2 283 621 6.0E-62
sp|P0C605|KGP1_MOUSE cGMP-dependent protein kinase 1 OS=Mus musculus GN=Prkg1 PE=1 SV=1 286 587 6.0E-62
sp|Q9Y5S2|MRCKB_HUMAN Serine/threonine-protein kinase MRCK beta OS=Homo sapiens GN=CDC42BPB PE=1 SV=2 285 577 1.0E-61
sp|Q7TT49|MRCKB_RAT Serine/threonine-protein kinase MRCK beta OS=Rattus norvegicus GN=Cdc42bpb PE=1 SV=1 285 577 1.0E-61
sp|Q13976|KGP1_HUMAN cGMP-dependent protein kinase 1 OS=Homo sapiens GN=PRKG1 PE=1 SV=3 286 587 1.0E-61
sp|Q7TT50|MRCKB_MOUSE Serine/threonine-protein kinase MRCK beta OS=Mus musculus GN=Cdc42bpb PE=1 SV=2 285 577 1.0E-61
sp|P00516|KGP1_BOVIN cGMP-dependent protein kinase 1 OS=Bos taurus GN=PRKG1 PE=1 SV=2 286 587 1.0E-61
sp|Q09013|DMPK_HUMAN Myotonin-protein kinase OS=Homo sapiens GN=DMPK PE=1 SV=3 279 577 1.0E-61
sp|O77676|KGP1_RABIT cGMP-dependent protein kinase 1 OS=Oryctolagus cuniculus GN=PRKG1 PE=1 SV=3 286 587 1.0E-61
sp|Q9VA38|WARTS_DROME Serine/threonine-protein kinase Warts OS=Drosophila melanogaster GN=wts PE=1 SV=1 278 578 2.0E-61
sp|Q63644|ROCK1_RAT Rho-associated protein kinase 1 OS=Rattus norvegicus GN=Rock1 PE=1 SV=1 282 608 3.0E-61
sp|P70335|ROCK1_MOUSE Rho-associated protein kinase 1 OS=Mus musculus GN=Rock1 PE=1 SV=1 282 632 4.0E-61
sp|Q13464|ROCK1_HUMAN Rho-associated protein kinase 1 OS=Homo sapiens GN=ROCK1 PE=1 SV=1 282 608 5.0E-61
sp|O77819|ROCK1_RABIT Rho-associated protein kinase 1 OS=Oryctolagus cuniculus GN=ROCK1 PE=1 SV=1 282 634 6.0E-61
sp|P92199|ROCK_CAEEL Rho-associated protein kinase let-502 OS=Caenorhabditis elegans GN=let-502 PE=1 SV=1 283 621 7.0E-61
sp|P54265|DMPK_MOUSE Myotonin-protein kinase OS=Mus musculus GN=Dmpk PE=1 SV=1 276 577 8.0E-61
sp|P32023|KGP25_DROME cGMP-dependent protein kinase, isozyme 2 forms cD5/T2 OS=Drosophila melanogaster GN=for PE=2 SV=3 286 576 1.0E-60
sp|Q6P5Z2|PKN3_HUMAN Serine/threonine-protein kinase N3 OS=Homo sapiens GN=PKN3 PE=1 SV=1 287 581 1.0E-60
sp|Q8K045|PKN3_MOUSE Serine/threonine-protein kinase N3 OS=Mus musculus GN=Pkn3 PE=1 SV=1 287 608 2.0E-60
sp|P38679|COT1_NEUCR Serine/threonine-protein kinase cot-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cot-1 PE=2 SV=2 239 576 4.0E-60
sp|Q03043|KGP24_DROME cGMP-dependent protein kinase, isozyme 2 forms cD4/T1/T3A/T3B OS=Drosophila melanogaster GN=for PE=1 SV=3 286 576 5.0E-60
sp|Q4V3C8|PDPK2_ARATH 3-phosphoinositide-dependent protein kinase 2 OS=Arabidopsis thaliana GN=PDPK2 PE=1 SV=1 290 554 2.0E-59
sp|Q9XF67|PDPK1_ARATH 3-phosphoinositide-dependent protein kinase 1 OS=Arabidopsis thaliana GN=PDPK1 PE=1 SV=1 290 554 4.0E-59
sp|P26818|ARBK2_BOVIN Beta-adrenergic receptor kinase 2 OS=Bos taurus GN=ADRBK2 PE=2 SV=1 286 595 4.0E-59
sp|O75116|ROCK2_HUMAN Rho-associated protein kinase 2 OS=Homo sapiens GN=ROCK2 PE=1 SV=4 282 618 4.0E-59
sp|O45797|WARTS_CAEEL Serine/threonine-protein kinase WARTS homolog OS=Caenorhabditis elegans GN=wts-1 PE=1 SV=1 277 577 6.0E-59
sp|P32865|GPRK1_DROME G protein-coupled receptor kinase 1 OS=Drosophila melanogaster GN=Gprk1 PE=2 SV=2 285 604 8.0E-59
sp|M3TYT0|ROCK2_PIG Rho-associated protein kinase 2 OS=Sus scrofa GN=ROCK2 PE=1 SV=1 282 627 2.0E-58
sp|Q28021|ROCK2_BOVIN Rho-associated protein kinase 2 OS=Bos taurus GN=ROCK2 PE=1 SV=1 282 627 2.0E-58
sp|Q3UYH7|ARBK2_MOUSE Beta-adrenergic receptor kinase 2 OS=Mus musculus GN=Adrbk2 PE=1 SV=2 286 595 2.0E-58
sp|P26819|ARBK2_RAT Beta-adrenergic receptor kinase 2 OS=Rattus norvegicus GN=Adrbk2 PE=2 SV=1 286 602 2.0E-58
sp|Q13237|KGP2_HUMAN cGMP-dependent protein kinase 2 OS=Homo sapiens GN=PRKG2 PE=1 SV=1 224 577 3.0E-58
sp|Q99MK8|ARBK1_MOUSE Beta-adrenergic receptor kinase 1 OS=Mus musculus GN=Adrbk1 PE=1 SV=2 286 602 4.0E-58
sp|Q9W1B0|GEK_DROME Serine/threonine-protein kinase Genghis Khan OS=Drosophila melanogaster GN=gek PE=1 SV=1 281 577 4.0E-58
sp|P70336|ROCK2_MOUSE Rho-associated protein kinase 2 OS=Mus musculus GN=Rock2 PE=1 SV=1 282 618 5.0E-58
sp|P26817|ARBK1_RAT Beta-adrenergic receptor kinase 1 OS=Rattus norvegicus GN=Adrbk1 PE=1 SV=1 286 602 7.0E-58
sp|Q9USX7|PPK22_SCHPO Serine/threonine-protein kinase ppk22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk22 PE=1 SV=1 291 574 9.0E-58
sp|P25098|ARBK1_HUMAN Beta-adrenergic receptor kinase 1 OS=Homo sapiens GN=ADRBK1 PE=1 SV=2 286 602 1.0E-57
sp|Q64595|KGP2_RAT cGMP-dependent protein kinase 2 OS=Rattus norvegicus GN=Prkg2 PE=1 SV=1 224 577 1.0E-57
sp|P21901|KAPL_APLCA Spermatozoon-associated protein kinase OS=Aplysia californica PE=2 SV=1 288 589 1.0E-57
sp|P21146|ARBK1_BOVIN Beta-adrenergic receptor kinase 1 OS=Bos taurus GN=ADRBK1 PE=1 SV=1 286 602 2.0E-57
sp|Q61410|KGP2_MOUSE cGMP-dependent protein kinase 2 OS=Mus musculus GN=Prkg2 PE=1 SV=1 224 577 2.0E-57
sp|O97627|ARBK1_DIDVI Beta-adrenergic receptor kinase 1 OS=Didelphis virginiana GN=ADRBK1 PE=1 SV=1 286 602 2.0E-57
sp|P35626|ARBK2_HUMAN Beta-adrenergic receptor kinase 2 OS=Homo sapiens GN=ADRBK2 PE=1 SV=2 286 595 3.0E-57
sp|Q09639|GRK2_CAEEL G protein-coupled receptor kinase 2 OS=Caenorhabditis elegans GN=grk-2 PE=3 SV=2 285 579 2.0E-56
sp|Q62868|ROCK2_RAT Rho-associated protein kinase 2 OS=Rattus norvegicus GN=Rock2 PE=1 SV=2 282 618 6.0E-56
sp|Q64682|ARBK1_MESAU Beta-adrenergic receptor kinase 1 OS=Mesocricetus auratus GN=ADRBK1 PE=2 SV=1 286 602 7.0E-56
sp|Q86UX6|ST32C_HUMAN Serine/threonine-protein kinase 32C OS=Homo sapiens GN=STK32C PE=1 SV=1 286 566 7.0E-56
sp|Q54UZ1|Y1639_DICDI Probable serine/threonine-protein kinase DDB_G0280717 OS=Dictyostelium discoideum GN=DDB_G0280717 PE=3 SV=1 286 576 8.0E-56
sp|Q03042|KGP1_DROME cGMP-dependent protein kinase, isozyme 1 OS=Drosophila melanogaster GN=Pkg21D PE=1 SV=2 286 577 2.0E-55
sp|Q9NY57|ST32B_HUMAN Serine/threonine-protein kinase 32B OS=Homo sapiens GN=STK32B PE=2 SV=1 285 583 9.0E-55
sp|Q9JJX8|ST32B_MOUSE Serine/threonine-protein kinase 32B OS=Mus musculus GN=Stk32b PE=2 SV=2 285 583 3.0E-54
sp|O94487|PPK35_SCHPO Serine/threonine-protein kinase ppk35 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk35 PE=1 SV=1 278 613 5.0E-54
sp|Q8QZV4|ST32C_MOUSE Serine/threonine-protein kinase 32C OS=Mus musculus GN=Stk32c PE=1 SV=1 286 566 5.0E-54
sp|Q8BGW6|ST32A_MOUSE Serine/threonine-protein kinase 32A OS=Mus musculus GN=Stk32a PE=2 SV=1 286 583 7.0E-54
sp|P93025|PHOT2_ARATH Phototropin-2 OS=Arabidopsis thaliana GN=PHOT2 PE=1 SV=2 275 551 7.0E-54
sp|Q9ST27|PHOT2_ORYSJ Phototropin-2 OS=Oryza sativa subsp. japonica GN=PHOT2 PE=1 SV=1 274 551 3.0E-53
sp|O76360|EGL4_CAEEL cGMP-dependent protein kinase egl-4 OS=Caenorhabditis elegans GN=egl-4 PE=1 SV=2 284 577 5.0E-53
sp|Q8WU08|ST32A_HUMAN Serine/threonine-protein kinase 32A OS=Homo sapiens GN=STK32A PE=1 SV=2 286 583 7.0E-53
sp|A8X6H1|EGL4_CAEBR cGMP-dependent protein kinase egl-4 OS=Caenorhabditis briggsae GN=egl-4 PE=3 SV=2 286 577 8.0E-53
sp|Q2QYY8|PHT1A_ORYSJ Phototropin-1A OS=Oryza sativa subsp. japonica GN=PHOT1A PE=1 SV=2 275 551 4.0E-52
sp|Q2RBR1|PHT1B_ORYSJ Phototropin-1B OS=Oryza sativa subsp. japonica GN=PHOT1B PE=1 SV=2 275 551 6.0E-52
sp|P16911|KDC1_DROME Protein kinase DC1 OS=Drosophila melanogaster GN=Pka-C2 PE=2 SV=1 280 501 6.0E-52
sp|P43250|GRK6_HUMAN G protein-coupled receptor kinase 6 OS=Homo sapiens GN=GRK6 PE=1 SV=2 291 607 7.0E-52
sp|Q9N0X0|AURKB_PIG Aurora kinase B OS=Sus scrofa GN=AURKB PE=2 SV=2 288 554 1.0E-51
sp|Q15835|RK_HUMAN Rhodopsin kinase OS=Homo sapiens GN=GRK1 PE=1 SV=1 289 612 2.0E-51
sp|P34100|PKD1_DICDI Developmentally-regulated protein kinase 1 OS=Dictyostelium discoideum GN=pkaD PE=2 SV=2 285 560 2.0E-51
sp|O70126|AURKB_MOUSE Aurora kinase B OS=Mus musculus GN=Aurkb PE=1 SV=2 288 554 7.0E-51
sp|P43249|GRK5_BOVIN G protein-coupled receptor kinase 5 OS=Bos taurus GN=GRK5 PE=1 SV=1 291 607 7.0E-51
sp|P97711|GRK6_RAT G protein-coupled receptor kinase 6 OS=Rattus norvegicus GN=Grk6 PE=2 SV=1 291 607 8.0E-51
sp|Q8VEB1|GRK5_MOUSE G protein-coupled receptor kinase 5 OS=Mus musculus GN=Grk5 PE=1 SV=2 291 607 1.0E-50
sp|P28327|RK_BOVIN Rhodopsin kinase OS=Bos taurus GN=GRK1 PE=1 SV=1 289 565 1.0E-50
sp|Q62833|GRK5_RAT G protein-coupled receptor kinase 5 OS=Rattus norvegicus GN=Grk5 PE=2 SV=1 291 607 2.0E-50
sp|P34947|GRK5_HUMAN G protein-coupled receptor kinase 5 OS=Homo sapiens GN=GRK5 PE=1 SV=1 291 607 2.0E-50
sp|P53894|CBK1_YEAST Serine/threonine-protein kinase CBK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CBK1 PE=1 SV=1 289 604 2.0E-50
sp|Q7YRC6|AURKB_BOVIN Aurora kinase B OS=Bos taurus GN=AURKB PE=2 SV=1 288 554 2.0E-50
sp|Q09898|SID2_SCHPO Serine/threonine-protein kinase sid2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sid2 PE=1 SV=1 278 616 3.0E-50
sp|O70293|GRK6_MOUSE G protein-coupled receptor kinase 6 OS=Mus musculus GN=Grk6 PE=1 SV=1 291 607 4.0E-50
sp|Q91820|AURAA_XENLA Aurora kinase A-A OS=Xenopus laevis GN=aurka-a PE=1 SV=1 288 561 4.0E-50
sp|O48963|PHOT1_ARATH Phototropin-1 OS=Arabidopsis thaliana GN=PHOT1 PE=1 SV=1 274 603 4.0E-50
sp|P32866|GPRK2_DROME G protein-coupled receptor kinase 2 OS=Drosophila melanogaster GN=Gprk2 PE=1 SV=3 291 576 1.0E-49
sp|O14578|CTRO_HUMAN Citron Rho-interacting kinase OS=Homo sapiens GN=CIT PE=1 SV=2 290 632 2.0E-49
sp|O55099|AURKB_RAT Aurora kinase B OS=Rattus norvegicus GN=Aurkb PE=1 SV=1 288 554 2.0E-49
sp|P70507|GRK4_RAT G protein-coupled receptor kinase 4 OS=Rattus norvegicus GN=Grk4 PE=1 SV=1 291 576 3.0E-49
sp|Q91819|AURAB_XENLA Aurora kinase A-B OS=Xenopus laevis GN=aurka-b PE=2 SV=3 274 546 3.0E-49
sp|Q9UQB9|AURKC_HUMAN Aurora kinase C OS=Homo sapiens GN=AURKC PE=1 SV=1 285 554 5.0E-49
sp|Q54PK9|PDPKB_DICDI 3-phosphoinositide-dependent protein kinase B OS=Dictyostelium discoideum GN=pdkB PE=3 SV=1 290 554 5.0E-49
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 280 548 6.0E-49
sp|P32328|DBF20_YEAST Serine/threonine-protein kinase DBF20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBF20 PE=1 SV=2 233 591 1.0E-48
sp|P32298|GRK4_HUMAN G protein-coupled receptor kinase 4 OS=Homo sapiens GN=GRK4 PE=1 SV=3 291 576 1.0E-48
sp|P22204|DBF2_YEAST Cell cycle protein kinase DBF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBF2 PE=1 SV=3 233 591 2.0E-48
sp|Q96GD4|AURKB_HUMAN Aurora kinase B OS=Homo sapiens GN=AURKB PE=1 SV=3 288 554 2.0E-48
sp|Q9Y7J6|PPK21_SCHPO Serine/threonine-protein kinase ppk21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk21 PE=1 SV=3 290 574 4.0E-48
sp|Q6DE08|AUKBA_XENLA Aurora kinase B-A OS=Xenopus laevis GN=aurkb-a PE=1 SV=1 270 562 4.0E-48
sp|Q6GPL3|AUKBB_XENLA Aurora kinase B-B OS=Xenopus laevis GN=aurkb-b PE=2 SV=1 285 554 5.0E-48
sp|Q63651|RK_RAT Rhodopsin kinase OS=Rattus norvegicus GN=Grk1 PE=1 SV=1 289 565 5.0E-48
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 291 546 6.0E-48
sp|Q755C4|IPL1_ASHGO Spindle assembly checkpoint kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IPL1 PE=3 SV=1 286 546 6.0E-48
sp|P97477|AURKA_MOUSE Aurora kinase A OS=Mus musculus GN=Aurka PE=1 SV=1 280 548 9.0E-48
sp|Q9WVL4|RK_MOUSE Rhodopsin kinase OS=Mus musculus GN=Grk1 PE=1 SV=1 289 565 2.0E-47
sp|A4IGM9|AURKB_XENTR Aurora kinase B OS=Xenopus tropicalis GN=aurkb PE=2 SV=1 285 554 2.0E-47
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 280 548 4.0E-47
sp|Q8WP15|GRK7_PIG G protein-coupled receptor kinase 7 OS=Sus scrofa GN=GRK7 PE=1 SV=1 291 573 9.0E-47
sp|O62846|KAPCG_MACMU cAMP-dependent protein kinase catalytic subunit gamma (Fragment) OS=Macaca mulatta GN=PRKACG PE=2 SV=3 289 460 1.0E-46
sp|P59241|AURKA_RAT Aurora kinase A OS=Rattus norvegicus GN=Aurka PE=1 SV=1 280 548 1.0E-46
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 280 548 2.0E-46
sp|O70291|GRK4_MOUSE G protein-coupled receptor kinase 4 OS=Mus musculus GN=Grk4 PE=2 SV=2 291 576 2.0E-46
sp|O88445|AURKC_MOUSE Aurora kinase C OS=Mus musculus GN=Aurkc PE=1 SV=1 288 545 2.0E-46
sp|Q09537|GRK1_CAEEL G protein-coupled receptor kinase 1 OS=Caenorhabditis elegans GN=grk-1 PE=3 SV=1 291 576 2.0E-46
sp|Q54P47|NDRC_DICDI Probable serine/threonine-protein kinase ndrC OS=Dictyostelium discoideum GN=ndrC PE=3 SV=1 241 584 3.0E-46
sp|Q622Z7|GRK1_CAEBR G protein-coupled receptor kinase 1 OS=Caenorhabditis briggsae GN=grk-1 PE=3 SV=1 291 576 5.0E-46
sp|Q9Z2G7|GRK7_ICTTR G protein-coupled receptor kinase 7 OS=Ictidomys tridecemlineatus GN=GRK7 PE=1 SV=1 291 577 5.0E-46
sp|Q0D4B2|CIPKL_ORYSJ CBL-interacting protein kinase 21 OS=Oryza sativa subsp. japonica GN=CIPK21 PE=2 SV=2 286 546 1.0E-45
sp|Q9LTW5|AGC15_ARATH Serine/threonine-protein kinase AGC1-5 OS=Arabidopsis thaliana GN=AGC1-5 PE=1 SV=1 275 576 1.0E-45
sp|Q9SEZ7|CIPKG_ARATH CBL-interacting serine/threonine-protein kinase 16 OS=Arabidopsis thaliana GN=CIPK16 PE=1 SV=1 282 572 1.0E-45
sp|Q5A3P6|PKH2_CANAL Serine/threonine-protein kinase PKH2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PKH2 PE=1 SV=1 275 552 1.0E-45
sp|Q8WMV0|GRK7_BOVIN G protein-coupled receptor kinase 7 OS=Bos taurus GN=GRK7 PE=1 SV=1 291 577 2.0E-45
sp|Q8WTQ7|GRK7_HUMAN G protein-coupled receptor kinase 7 OS=Homo sapiens GN=GRK7 PE=1 SV=1 291 577 2.0E-45
sp|Q6CWQ4|IPL1_KLULA Spindle assembly checkpoint kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPL1 PE=3 SV=1 286 546 4.0E-45
sp|Q6FV07|IPL1_CANGA Spindle assembly checkpoint kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=IPL1 PE=3 SV=1 281 546 5.0E-45
sp|Q6NW76|AURKB_DANRE Aurora kinase B OS=Danio rerio GN=aurkb PE=2 SV=1 279 554 5.0E-45
sp|Q753D9|PKH3_ASHGO Serine/threonine-protein kinase PKH3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PKH3 PE=3 SV=1 290 551 7.0E-45
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 291 532 8.0E-45
sp|O22932|CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11 OS=Arabidopsis thaliana GN=CIPK11 PE=1 SV=1 291 546 9.0E-45
sp|Q12701|KSG1_SCHPO Serine/threonine-protein kinase ksg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ksg1 PE=1 SV=2 287 565 1.0E-44
sp|Q8BW96|KCC1D_MOUSE Calcium/calmodulin-dependent protein kinase type 1D OS=Mus musculus GN=Camk1d PE=1 SV=2 291 546 2.0E-44
sp|Q03407|PKH1_YEAST Serine/threonine-protein kinase PKH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH1 PE=1 SV=1 285 551 3.0E-44
sp|O64629|AUR3_ARATH Serine/threonine-protein kinase Aurora-3 OS=Arabidopsis thaliana GN=AUR3 PE=2 SV=1 288 546 5.0E-44
sp|Q9LP51|CIPKI_ARATH CBL-interacting serine/threonine-protein kinase 18 OS=Arabidopsis thaliana GN=CIPK18 PE=1 SV=1 291 532 6.0E-44
sp|Q6ERS0|CIPKR_ORYSJ Putative CBL-interacting protein kinase 27 OS=Oryza sativa subsp. japonica GN=CIPK27 PE=3 SV=1 291 569 7.0E-44
sp|Q8IU85|KCC1D_HUMAN Calcium/calmodulin-dependent protein kinase type 1D OS=Homo sapiens GN=CAMK1D PE=1 SV=1 291 546 8.0E-44
sp|Q9FJ54|CIPKK_ARATH CBL-interacting serine/threonine-protein kinase 20 OS=Arabidopsis thaliana GN=CIPK20 PE=1 SV=1 282 532 8.0E-44
sp|Q84VQ3|CIPKQ_ARATH CBL-interacting serine/threonine-protein kinase 26 OS=Arabidopsis thaliana GN=CIPK26 PE=1 SV=2 279 612 1.0E-43
sp|Q7X996|CIPK2_ORYSJ CBL-interacting protein kinase 2 OS=Oryza sativa subsp. japonica GN=CIPK2 PE=2 SV=1 284 583 1.0E-43
sp|Q683C9|AUR2_ARATH Serine/threonine-protein kinase Aurora-2 OS=Arabidopsis thaliana GN=AUR2 PE=2 SV=2 290 546 1.0E-43
sp|Q9STV4|CIPK8_ARATH CBL-interacting serine/threonine-protein kinase 8 OS=Arabidopsis thaliana GN=CIPK8 PE=1 SV=1 287 594 1.0E-43
sp|B6CZ17|GRK7A_XENLA G protein-coupled receptor kinase 7A OS=Xenopus laevis GN=grk7-a PE=1 SV=1 291 576 2.0E-43
sp|F4I4F2|RHS3_ARATH Serine/threonine-protein kinase RHS3 OS=Arabidopsis thaliana GN=RHS3 PE=1 SV=1 275 551 2.0E-43
sp|Q61XD3|AIR2_CAEBR Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis briggsae GN=air-2 PE=3 SV=1 282 543 3.0E-43
sp|Q12236|PKH2_YEAST Serine/threonine-protein kinase PKH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH2 PE=1 SV=1 288 552 3.0E-43
sp|P49025|CTRO_MOUSE Citron Rho-interacting kinase OS=Mus musculus GN=Cit PE=1 SV=3 290 632 3.0E-43
sp|Q9FJ55|CIPKJ_ARATH CBL-interacting serine/threonine-protein kinase 19 OS=Arabidopsis thaliana GN=CIPK19 PE=2 SV=1 286 532 5.0E-43
sp|Q9LDI3|CIPKO_ARATH CBL-interacting serine/threonine-protein kinase 24 OS=Arabidopsis thaliana GN=CIPK24 PE=1 SV=1 287 547 5.0E-43
sp|Q9LWM4|CIPK5_ORYSJ CBL-interacting protein kinase 5 OS=Oryza sativa subsp. japonica GN=CIPK5 PE=2 SV=1 291 546 6.0E-43
sp|P25323|MYLKA_DICDI Myosin light chain kinase A OS=Dictyostelium discoideum GN=mlkA PE=1 SV=2 291 548 6.0E-43
sp|Q9M077|AUR1_ARATH Serine/threonine-protein kinase Aurora-1 OS=Arabidopsis thaliana GN=AUR1 PE=1 SV=1 288 546 7.0E-43
sp|Q68Y49|CIPKJ_ORYSJ CBL-interacting protein kinase 19 OS=Oryza sativa subsp. japonica GN=CIPK19 PE=1 SV=1 282 532 1.0E-42
sp|Q1PFB9|AGC17_ARATH Serine/threonine-protein kinase AGC1-7 OS=Arabidopsis thaliana GN=AGC1-7 PE=1 SV=1 275 579 1.0E-42
sp|Q05999|D6KL3_ARATH Serine/threonine-protein kinase D6PKL3 OS=Arabidopsis thaliana GN=D6PKL3 PE=1 SV=1 274 575 2.0E-42
sp|Q54WX4|AURK_DICDI Aurora kinase OS=Dictyostelium discoideum GN=aurK PE=1 SV=1 285 546 2.0E-42
sp|O01427|AIR2_CAEEL Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis elegans GN=air-2 PE=1 SV=2 282 531 2.0E-42
sp|Q54C18|Y9452_DICDI Probable serine/threonine-protein kinase DDB_G0293276 OS=Dictyostelium discoideum GN=DDB_G0293276 PE=3 SV=1 290 574 3.0E-42
sp|Q9LEU7|CIPK5_ARATH CBL-interacting serine/threonine-protein kinase 5 OS=Arabidopsis thaliana GN=CIPK5 PE=2 SV=1 291 532 3.0E-42
sp|B6CZ18|GRK7B_XENLA G protein-coupled receptor kinase 7B OS=Xenopus laevis GN=grk7-b PE=1 SV=1 291 576 4.0E-42
sp|Q03306|PKH3_YEAST Serine/threonine-protein kinase PKH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH3 PE=1 SV=1 290 551 5.0E-42
sp|Q6ZLP5|CIPKN_ORYSJ CBL-interacting protein kinase 23 OS=Oryza sativa subsp. japonica GN=CIPK23 PE=2 SV=1 283 532 5.0E-42
sp|Q9LGV5|CIPK1_ORYSJ CBL-interacting protein kinase 1 OS=Oryza sativa subsp. japonica GN=CIPK1 PE=2 SV=1 291 587 6.0E-42
sp|O70150|KCC1B_RAT Calcium/calmodulin-dependent protein kinase type 1B OS=Rattus norvegicus GN=Pnck PE=1 SV=1 291 532 6.0E-42
sp|Q93VD3|CIPKN_ARATH CBL-interacting serine/threonine-protein kinase 23 OS=Arabidopsis thaliana GN=CIPK23 PE=1 SV=1 291 532 6.0E-42
sp|Q59KM8|DBF2_CANAL Cell cycle protein kinase DBF2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBF2 PE=2 SV=1 274 577 8.0E-42
sp|Q9QYK9|KCC1B_MOUSE Calcium/calmodulin-dependent protein kinase type 1B OS=Mus musculus GN=Pnck PE=1 SV=1 291 532 8.0E-42
sp|Q1XHL7|GRK7B_DANRE G protein-coupled receptor kinase 7B OS=Danio rerio GN=grk7b PE=1 SV=2 291 576 1.0E-41
sp|Q75L42|CIPKH_ORYSJ CBL-interacting protein kinase 17 OS=Oryza sativa subsp. japonica GN=CIPK17 PE=2 SV=1 291 547 1.0E-41
sp|Q6BVA0|IPL1_DEBHA Spindle assembly checkpoint kinase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=IPL1 PE=3 SV=2 273 546 1.0E-41
sp|Q8W1D5|CIPKP_ARATH CBL-interacting serine/threonine-protein kinase 25 OS=Arabidopsis thaliana GN=CIPK25 PE=2 SV=1 291 532 1.0E-41
sp|Q2QY53|CIPKW_ORYSJ CBL-interacting protein kinase 32 OS=Oryza sativa subsp. japonica GN=CIPK32 PE=2 SV=2 279 532 1.0E-41
sp|Q6C3J2|IPL1_YARLI Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPL1 PE=3 SV=1 288 546 2.0E-41
sp|Q2V452|CIPK3_ARATH CBL-interacting serine/threonine-protein kinase 3 OS=Arabidopsis thaliana GN=CIPK3 PE=1 SV=2 279 577 2.0E-41
sp|Q54CY9|MYLKD_DICDI Probable myosin light chain kinase DDB_G0292624 OS=Dictyostelium discoideum GN=DDB_G0292624 PE=3 SV=1 286 546 2.0E-41
sp|Q63450|KCC1A_RAT Calcium/calmodulin-dependent protein kinase type 1 OS=Rattus norvegicus GN=Camk1 PE=1 SV=2 291 546 2.0E-41
sp|Q91YS8|KCC1A_MOUSE Calcium/calmodulin-dependent protein kinase type 1 OS=Mus musculus GN=Camk1 PE=1 SV=1 291 546 2.0E-41
sp|Q5JLS2|CIPKC_ORYSJ CBL-interacting protein kinase 12 OS=Oryza sativa subsp. japonica GN=CIPK12 PE=1 SV=1 291 532 3.0E-41
sp|Q96NX5|KCC1G_HUMAN Calcium/calmodulin-dependent protein kinase type 1G OS=Homo sapiens GN=CAMK1G PE=1 SV=3 291 584 3.0E-41
sp|O22971|CIPKD_ARATH CBL-interacting serine/threonine-protein kinase 13 OS=Arabidopsis thaliana GN=CIPK13 PE=1 SV=2 281 546 3.0E-41
sp|Q91VB2|KCC1G_MOUSE Calcium/calmodulin-dependent protein kinase type 1G OS=Mus musculus GN=Camk1g PE=1 SV=1 291 584 4.0E-41
sp|Q6P2M8|KCC1B_HUMAN Calcium/calmodulin-dependent protein kinase type 1B OS=Homo sapiens GN=PNCK PE=2 SV=2 291 532 4.0E-41
sp|Q14012|KCC1A_HUMAN Calcium/calmodulin-dependent protein kinase type 1 OS=Homo sapiens GN=CAMK1 PE=1 SV=1 291 546 4.0E-41
sp|Q5QNM6|CIPKD_ORYSJ Putative CBL-interacting protein kinase 13 OS=Oryza sativa subsp. japonica GN=CIPK13 PE=3 SV=1 268 539 4.0E-41
sp|Q7TNJ7|KCC1G_RAT Calcium/calmodulin-dependent protein kinase type 1G OS=Rattus norvegicus GN=Camk1g PE=2 SV=1 291 584 4.0E-41
sp|Q10LQ2|CIPKA_ORYSJ CBL-interacting protein kinase 10 OS=Oryza sativa subsp. japonica GN=CIPK10 PE=2 SV=1 282 548 5.0E-41
sp|Q0JI49|CIPKB_ORYSJ CBL-interacting protein kinase 11 OS=Oryza sativa subsp. japonica GN=CIPK11 PE=2 SV=1 291 532 5.0E-41
sp|Q54MH0|FHKD_DICDI Probable serine/threonine-protein kinase fhkD OS=Dictyostelium discoideum GN=fhkD PE=3 SV=1 291 550 8.0E-41
sp|Q2RAX3|CIPKX_ORYSJ CBL-interacting protein kinase 33 OS=Oryza sativa subsp. japonica GN=CIPK33 PE=2 SV=1 279 532 8.0E-41
sp|D7UQM5|AURK_PATPE Aurora kinase OS=Patiria pectinifera GN=aur PE=1 SV=1 283 536 9.0E-41
sp|O65554|CIPK6_ARATH CBL-interacting serine/threonine-protein kinase 6 OS=Arabidopsis thaliana GN=CIPK6 PE=1 SV=1 291 532 9.0E-41
sp|Q5W736|CIPKI_ORYSJ CBL-interacting protein kinase 18 OS=Oryza sativa subsp. japonica GN=CIPK18 PE=2 SV=1 282 532 1.0E-40
sp|Q5JLD8|CIPK8_ORYSJ CBL-interacting protein kinase 8 OS=Oryza sativa subsp. japonica GN=CIPK8 PE=2 SV=1 287 594 2.0E-40
sp|P92937|CIPKF_ARATH CBL-interacting serine/threonine-protein kinase 15 OS=Arabidopsis thaliana GN=CIPK15 PE=1 SV=2 282 532 3.0E-40
sp|Q4KTY1|KPSH1_PINFU Serine/threonine-protein kinase H1 homolog OS=Pinctada fucata GN=PSKH1 PE=2 SV=1 291 534 3.0E-40
sp|Q10SC8|CIPK9_ORYSJ CBL-interacting protein kinase 9 OS=Oryza sativa subsp. japonica GN=CIPK9 PE=2 SV=1 281 532 4.0E-40
sp|Q5JLQ9|CIPKU_ORYSJ CBL-interacting protein kinase 30 OS=Oryza sativa subsp. japonica GN=CIPK30 PE=2 SV=1 291 547 4.0E-40
sp|Q501V0|KPSH1_DANRE Serine/threonine-protein kinase H1 homolog OS=Danio rerio GN=pskh1 PE=2 SV=2 291 546 5.0E-40
sp|Q9C562|CIPKA_ARATH CBL-interacting serine/threonine-protein kinase 10 OS=Arabidopsis thaliana GN=CIPK10 PE=1 SV=1 289 547 1.0E-39
sp|Q6BLJ9|CBK1_DEBHA Serine/threonine-protein kinase CBK1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CBK1 PE=3 SV=2 277 436 1.0E-39
sp|Q69Q47|CIPKO_ORYSJ CBL-interacting protein kinase 24 OS=Oryza sativa subsp. japonica GN=CIPK24 PE=1 SV=1 285 532 2.0E-39
sp|Q49HM9|GRK7A_DANRE G-protein-coupled receptor kinase 7A OS=Danio rerio GN=grk7a PE=1 SV=2 291 581 2.0E-39
sp|Q6ERS4|CIPKG_ORYSJ CBL-interacting protein kinase 16 OS=Oryza sativa subsp. japonica GN=CIPK16 PE=2 SV=1 285 546 3.0E-39
sp|Q38997|KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana GN=KIN10 PE=1 SV=2 290 548 3.0E-39
sp|Q8TDC3|BRSK1_HUMAN Serine/threonine-protein kinase BRSK1 OS=Homo sapiens GN=BRSK1 PE=1 SV=2 291 546 5.0E-39
sp|Q6X4A2|CIPKV_ORYSJ CBL-interacting protein kinase 31 OS=Oryza sativa subsp. japonica GN=CIPK31 PE=1 SV=1 279 612 5.0E-39
sp|Q86AD7|MYLKB_DICDI Probable myosin light chain kinase DDB_G0271550 OS=Dictyostelium discoideum GN=DDB_G0271550 PE=3 SV=1 287 546 6.0E-39
sp|P34101|FHKC_DICDI Probable serine/threonine-protein kinase fhkC OS=Dictyostelium discoideum GN=fhkC PE=3 SV=2 289 546 6.0E-39
sp|B2DD29|BRSK1_RAT Serine/threonine-protein kinase BRSK1 OS=Rattus norvegicus GN=Brsk1 PE=1 SV=1 291 546 7.0E-39
sp|Q5RJI5|BRSK1_MOUSE Serine/threonine-protein kinase BRSK1 OS=Mus musculus GN=Brsk1 PE=1 SV=1 291 546 8.0E-39
sp|Q5AG71|HSL1_CANAL Serine/threonine-protein kinase HSL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSL1 PE=1 SV=1 282 572 1.0E-38
sp|Q0V7M1|KPSH1_BOVIN Serine/threonine-protein kinase H1 OS=Bos taurus GN=PSKH1 PE=2 SV=1 291 534 1.0E-38
sp|Q9SUL7|CIPK4_ARATH CBL-interacting serine/threonine-protein kinase 4 OS=Arabidopsis thaliana GN=CIPK4 PE=1 SV=1 280 532 1.0E-38
sp|P11801|KPSH1_HUMAN Serine/threonine-protein kinase H1 OS=Homo sapiens GN=PSKH1 PE=1 SV=4 291 534 2.0E-38
sp|Q9VKN7|AURKB_DROME Aurora kinase B OS=Drosophila melanogaster GN=ial PE=1 SV=1 290 532 2.0E-38
sp|P08414|KCC4_MOUSE Calcium/calmodulin-dependent protein kinase type IV OS=Mus musculus GN=Camk4 PE=1 SV=2 291 568 2.0E-38
sp|O60285|NUAK1_HUMAN NUAK family SNF1-like kinase 1 OS=Homo sapiens GN=NUAK1 PE=1 SV=1 291 531 3.0E-38
sp|Q641K5|NUAK1_MOUSE NUAK family SNF1-like kinase 1 OS=Mus musculus GN=Nuak1 PE=1 SV=1 291 531 4.0E-38
sp|Q6H7U5|CIPKQ_ORYSJ CBL-interacting protein kinase 26 OS=Oryza sativa subsp. japonica GN=CIPK26 PE=2 SV=1 288 532 5.0E-38
sp|Q96QS6|KPSH2_HUMAN Serine/threonine-protein kinase H2 OS=Homo sapiens GN=PSKH2 PE=2 SV=1 291 545 5.0E-38
sp|B4NSS9|DCLK_DROSI Serine/threonine-protein kinase GD17699 OS=Drosophila simulans GN=GD17699 PE=3 SV=1 291 545 6.0E-38
sp|B4IMC3|DCLK_DROSE Serine/threonine-protein kinase GM11705 OS=Drosophila sechellia GN=GM11705 PE=3 SV=1 291 545 6.0E-38
sp|P0C8M8|CCR1_MAIZE Probable serine/threonine-protein kinase CCRP1 OS=Zea mays GN=CCRP1 PE=1 SV=1 276 546 9.0E-38
sp|Q869W6|MYLKG_DICDI Probable myosin light chain kinase DDB_G0275057 OS=Dictyostelium discoideum GN=DDB_G0275057 PE=3 SV=1 288 531 9.0E-38
sp|Q8RWC9|CIPK1_ARATH CBL-interacting serine/threonine-protein kinase 1 OS=Arabidopsis thaliana GN=CIPK1 PE=1 SV=2 280 546 1.0E-37
sp|P45894|AAPK1_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Caenorhabditis elegans GN=aak-1 PE=2 SV=2 283 531 1.0E-37
sp|Q9MAM1|CIPK9_ARATH CBL-interacting serine/threonine-protein kinase 9 OS=Arabidopsis thaliana GN=CIPK9 PE=1 SV=2 281 532 1.0E-37
sp|Q9NRP7|STK36_HUMAN Serine/threonine-protein kinase 36 OS=Homo sapiens GN=STK36 PE=1 SV=2 288 546 1.0E-37
sp|Q16566|KCC4_HUMAN Calcium/calmodulin-dependent protein kinase type IV OS=Homo sapiens GN=CAMK4 PE=1 SV=1 291 568 1.0E-37
sp|Q5MPA9|DCLK2_RAT Serine/threonine-protein kinase DCLK2 OS=Rattus norvegicus GN=Dclk2 PE=1 SV=2 288 545 2.0E-37
sp|D2I3C6|DCLK2_AILME Serine/threonine-protein kinase DCLK2 OS=Ailuropoda melanoleuca GN=DCLK2 PE=3 SV=1 288 545 2.0E-37
sp|P13234|KCC4_RAT Calcium/calmodulin-dependent protein kinase type IV OS=Rattus norvegicus GN=Camk4 PE=1 SV=3 291 568 2.0E-37
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 286 531 2.0E-37
sp|A8X6H4|CMK1_CAEBR Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis briggsae GN=cmk-1 PE=3 SV=3 289 546 2.0E-37
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 286 531 3.0E-37
sp|P31034|CBK1_KLULA Serine/threonine-protein kinase CBK1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CBK1 PE=3 SV=2 289 436 3.0E-37
sp|Q9TXJ0|CMK1_CAEEL Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis elegans GN=cmk-1 PE=1 SV=1 289 546 3.0E-37
sp|Q91YA2|KPSH1_MOUSE Serine/threonine-protein kinase H1 OS=Mus musculus GN=Pskh1 PE=2 SV=3 291 534 3.0E-37
sp|Q8MYQ1|Y31E_CAEEL Putative serine/threonine-protein kinase F31E3.2 OS=Caenorhabditis elegans GN=F31E3.2 PE=3 SV=1 291 580 4.0E-37
sp|P38991|IPL1_YEAST Spindle assembly checkpoint kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IPL1 PE=1 SV=1 286 546 4.0E-37
sp|Q5RAJ5|STK36_PONAB Serine/threonine-protein kinase 36 OS=Pongo abelii GN=STK36 PE=2 SV=1 288 546 4.0E-37
sp|Q7PLI7|DCLK_DROME Serine/threonine-protein kinase CG17528 OS=Drosophila melanogaster GN=CG17528 PE=1 SV=1 291 532 4.0E-37
sp|P50528|PLO1_SCHPO Serine/threonine-protein kinase plo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=plo1 PE=1 SV=1 297 548 5.0E-37
sp|Q66HE5|NUAK2_RAT NUAK family SNF1-like kinase 2 OS=Rattus norvegicus GN=Nuak2 PE=1 SV=1 291 531 6.0E-37
sp|Q2RBF0|CIPKF_ORYSJ CBL-interacting protein kinase 15 OS=Oryza sativa subsp. japonica GN=CIPK15 PE=2 SV=1 279 546 7.0E-37
sp|Q60EY8|CIPKK_ORYSJ CBL-interacting protein kinase 20 OS=Oryza sativa subsp. japonica GN=CIPK20 PE=2 SV=1 284 546 9.0E-37
sp|Q8N568|DCLK2_HUMAN Serine/threonine-protein kinase DCLK2 OS=Homo sapiens GN=DCLK2 PE=2 SV=4 288 545 9.0E-37
sp|Q76P07|Y7165_DICDI Probable serine/threonine-protein kinase DDB_G0277165 OS=Dictyostelium discoideum GN=DDB_G0277165 PE=3 SV=1 291 546 1.0E-36
sp|A3B529|CIPKS_ORYSJ CBL-interacting protein kinase 28 OS=Oryza sativa subsp. japonica GN=CIPK28 PE=2 SV=2 288 585 1.0E-36
sp|U4PR86|MELK_CAEEL Maternal embryonic leucine zipper kinase OS=Caenorhabditis elegans GN=pig-1 PE=1 SV=1 297 559 1.0E-36
sp|Q2QYM3|CIPKE_ORYSJ CBL-interacting protein kinase 14 OS=Oryza sativa subsp. japonica GN=CIPK14 PE=2 SV=1 279 546 1.0E-36
sp|Q2QAV0|TIO_ARATH Serine/threonine-protein kinase TIO OS=Arabidopsis thaliana GN=TIO PE=1 SV=1 288 546 2.0E-36
sp|Q95ZQ4|AAPK2_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Caenorhabditis elegans GN=aak-2 PE=1 SV=2 284 546 2.0E-36
sp|Q69ZM6|STK36_MOUSE Serine/threonine-protein kinase 36 OS=Mus musculus GN=Stk36 PE=1 SV=3 288 546 2.0E-36
sp|Q2QMI0|CIPK4_ORYSJ CBL-interacting protein kinase 4 OS=Oryza sativa subsp. japonica GN=CIPK4 PE=2 SV=2 291 546 2.0E-36
sp|Q5N942|SAPK4_ORYSJ Serine/threonine-protein kinase SAPK4 OS=Oryza sativa subsp. japonica GN=SAPK4 PE=2 SV=2 288 546 2.0E-36
sp|Q9XIW0|CIPK7_ARATH CBL-interacting serine/threonine-protein kinase 7 OS=Arabidopsis thaliana GN=CIPK7 PE=1 SV=1 281 532 2.0E-36
sp|B4IT27|DCLK_DROYA Serine/threonine-protein kinase GE16371 OS=Drosophila yakuba GN=GE16371 PE=3 SV=2 291 532 2.0E-36
sp|O94168|SNF1_CANTR Carbon catabolite-derepressing protein kinase OS=Candida tropicalis GN=SNF1 PE=3 SV=1 287 532 2.0E-36
sp|Q59S66|IPL1_CANAL Spindle assembly checkpoint kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IPL1 PE=3 SV=1 285 533 2.0E-36
sp|Q9C098|DCLK3_HUMAN Serine/threonine-protein kinase DCLK3 OS=Homo sapiens GN=DCLK3 PE=2 SV=2 291 546 2.0E-36
sp|Q5EG47|AAPK1_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Mus musculus GN=Prkaa1 PE=1 SV=2 284 546 3.0E-36
sp|Q6Z9F4|CIPK6_ORYSJ CBL-interacting protein kinase 6 OS=Oryza sativa subsp. japonica GN=CIPK6 PE=2 SV=1 291 546 3.0E-36
sp|Q8BRK8|AAPK2_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Mus musculus GN=Prkaa2 PE=1 SV=3 284 546 3.0E-36
sp|Q94CG0|CIPKL_ARATH CBL-interacting serine/threonine-protein kinase 21 OS=Arabidopsis thaliana GN=CIPK21 PE=1 SV=1 284 532 3.0E-36
sp|Q0D4J7|SAPK2_ORYSJ Serine/threonine-protein kinase SAPK2 OS=Oryza sativa subsp. japonica GN=SAPK2 PE=1 SV=1 288 546 4.0E-36
sp|B3NKK1|DCLK_DROER Serine/threonine-protein kinase GG21441 OS=Drosophila erecta GN=GG21441 PE=3 SV=1 291 532 4.0E-36
sp|O75582|KS6A5_HUMAN Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens GN=RPS6KA5 PE=1 SV=1 295 536 5.0E-30
sp|Q5R4K3|KS6A5_PONAB Ribosomal protein S6 kinase alpha-5 OS=Pongo abelii GN=RPS6KA5 PE=2 SV=1 295 536 5.0E-29
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 196 585 7.0E-29
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 196 585 7.0E-29
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 158 550 4.0E-28
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 291 546 6.0E-28
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 295 545 9.0E-28
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 295 550 1.0E-27
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 295 597 8.0E-27
sp|Q7TPS0|KS6A6_MOUSE Ribosomal protein S6 kinase alpha-6 OS=Mus musculus GN=Rps6ka6 PE=1 SV=2 289 566 1.0E-26
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 291 545 1.0E-26
sp|Q5F3L1|KS6A5_CHICK Ribosomal protein S6 kinase alpha-5 OS=Gallus gallus GN=RPS6KA5 PE=2 SV=1 295 532 1.0E-26
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 289 541 4.0E-26
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 286 534 5.0E-26
sp|Q6BLJ9|CBK1_DEBHA Serine/threonine-protein kinase CBK1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CBK1 PE=3 SV=2 450 629 6.0E-26
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 169 534 1.0E-24
sp|P31034|CBK1_KLULA Serine/threonine-protein kinase CBK1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CBK1 PE=3 SV=2 450 576 2.0E-24
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 296 548 3.0E-24
sp|Q8C050|KS6A5_MOUSE Ribosomal protein S6 kinase alpha-5 OS=Mus musculus GN=Rps6ka5 PE=1 SV=2 365 536 3.0E-24
sp|Q9UK32|KS6A6_HUMAN Ribosomal protein S6 kinase alpha-6 OS=Homo sapiens GN=RPS6KA6 PE=1 SV=1 289 534 5.0E-24
sp|P10666|KS6AB_XENLA Ribosomal protein S6 kinase 2 beta OS=Xenopus laevis PE=2 SV=1 291 489 3.0E-21
sp|O75676|KS6A4_HUMAN Ribosomal protein S6 kinase alpha-4 OS=Homo sapiens GN=RPS6KA4 PE=1 SV=1 297 536 8.0E-18
sp|Q9Z2B9|KS6A4_MOUSE Ribosomal protein S6 kinase alpha-4 OS=Mus musculus GN=Rps6ka4 PE=1 SV=2 297 536 1.0E-17
sp|Q9V3I5|JIL1_DROME Chromosomal serine/threonine-protein kinase JIL-1 OS=Drosophila melanogaster GN=JIL-1 PE=1 SV=1 244 591 1.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0004674 protein serine/threonine kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0008152 metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0006793 phosphorus metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0044267 cellular protein metabolic process No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0016301 kinase activity No
GO:0044260 cellular macromolecule metabolic process No
GO:0008144 drug binding No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0032555 purine ribonucleotide binding No
GO:0016310 phosphorylation No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006464 cellular protein modification process No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0019538 protein metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0006796 phosphate-containing compound metabolic process No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No
GO:0043170 macromolecule metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|965
MSWKLTKKLKETHLGPLSAFSRSPSTSTITDKDEKAPGATTPTSENAIAASEAMTQSPVVKPPKPGILVVTLHEG
QGFSLPEQHRNAFVSQHQGSLSSNNAGSMASSVRPSSSQRVAGSFINGSNRPHSSAGGFGGIPTNHGRISGKYMP
YALLDFDKVQVFVNSVDGNPENPLWAGGNTQYKFDVSRVTELVIHLYMRNPSAPPSSGRSQDIFLGVARINPRFE
ERQPYVEDPKASKKDREKAAAEHAQRQRGDGQCGVDWVDVQYGSGKIKVGVEYVETRAGKLKIEDFELLKVVGKG
SFGKVMQVRKKDTNRIYALKTIRKAHIISRSEVAHTLAERSVLAQINNPFIVPLKFSFQSPEKLYFVLAFVNGGE
LFHHLQKEHRFDVNRSRFYTAELLCALECLHGFSVIYRDLKPENILLDYQGHIALCDFGLCKLDMKDEDRTNTFC
GTPEYLAPELLMGKGYNKTVDWWTLGVLLYEMLTGLPPFYDENTNEMYRKILSEPLHFSDVVPPAAKDLLTKLLN
RNPEERLGANGSAEIKAHPFFHAIDWRKLLQRKYEPTFKPSVADALDTANFDPEFTSEAPQDSYVEGPMLSQTMQ
NQFQGFSYNRPIAGLGDAGGSVKDPSFVGSMQDNR*
Coding >Hirsu2|965
ATGTCGTGGAAACTCACCAAGAAACTCAAAGAAACCCATCTCGGCCCTCTGAGCGCCTTCTCCCGATCTCCCTCC
ACCTCGACCATCACAGACAAGGACGAAAAAGCCCCCGGGGCCACGACGCCTACCTCGGAAAATGCCATCGCCGCC
TCCGAAGCCATGACCCAGAGCCCCGTCGTCAAGCCGCCGAAGCCCGGCATCCTCGTCGTCACCCTCCATGAGGGC
CAGGGCTTCTCGCTTCCCGAGCAGCATCGGAACGCCTTCGTCTCCCAGCACCAGGGCTCGCTGTCGTCAAACAAT
GCCGGCTCTATGGCCTCCTCGGTACGGCCTTCGTCCTCGCAACGCGTCGCCGGCTCCTTCATCAACGGCTCCAAC
CGGCCGCACTCGTCCGCCGGCGGCTTCGGCGGCATCCCCACCAACCACGGCCGCATCTCGGGCAAGTACATGCCC
TACGCCCTCCTCGACTTCGACAAGGTCCAGGTCTTCGTCAACTCGGTCGACGGCAACCCCGAGAACCCGCTGTGG
GCCGGCGGCAACACCCAGTACAAGTTTGACGTCTCCCGCGTCACCGAGCTCGTCATCCACCTCTACATGAGGAAC
CCCAGCGCACCCCCGAGCTCGGGCCGGAGCCAGGATATCTTCCTCGGCGTCGCCCGCATCAACCCCCGCTTCGAG
GAGCGCCAGCCGTACGTAGAGGACCCCAAGGCCAGCAAGAAGGACCGCGAGAAGGCTGCGGCCGAGCACGCCCAG
CGGCAACGGGGCGACGGCCAATGCGGCGTCGACTGGGTCGACGTCCAGTACGGCAGCGGCAAGATCAAGGTCGGC
GTTGAGTACGTCGAGACGCGCGCCGGCAAGCTCAAGATCGAGGACTTTGAGCTGCTCAAGGTCGTCGGCAAGGGC
AGCTTCGGCAAGGTGATGCAGGTGCGCAAGAAGGACACGAACCGCATCTACGCCCTCAAGACCATCCGCAAGGCC
CACATCATCTCGCGCTCCGAGGTGGCCCACACGCTGGCCGAGCGCTCCGTCCTGGCCCAGATCAACAACCCGTTC
ATCGTGCCGCTCAAGTTCAGCTTCCAGTCGCCCGAGAAGCTCTACTTCGTCCTGGCCTTTGTCAACGGCGGCGAG
CTCTTCCACCACCTGCAGAAGGAGCACCGCTTCGACGTCAACCGCTCGCGCTTCTACACGGCCGAGCTGCTGTGC
GCGCTCGAGTGTCTGCACGGCTTCAGCGTCATCTACCGCGACCTCAAGCCCGAGAACATCCTGCTCGACTACCAG
GGCCACATCGCCCTCTGCGACTTCGGCCTGTGCAAGCTCGACATGAAGGACGAGGACCGGACCAACACCTTCTGC
GGTACACCCGAGTACCTGGCGCCCGAGCTGCTGATGGGCAAGGGCTACAACAAGACGGTCGACTGGTGGACCTTG
GGCGTGCTGCTGTACGAGATGCTGACGGGCCTGCCGCCCTTTTACGACGAGAACACCAACGAGATGTACCGCAAG
ATCCTGTCGGAGCCGCTGCACTTCTCCGACGTGGTGCCGCCCGCGGCCAAGGACCTACTGACGAAGCTGCTCAAC
CGCAACCCCGAGGAGCGGCTGGGCGCCAACGGCTCGGCCGAGATCAAGGCCCACCCCTTCTTCCACGCCATCGAC
TGGCGGAAGCTGCTGCAGCGCAAGTACGAGCCGACGTTTAAGCCCAGCGTGGCGGACGCCCTGGACACGGCCAAC
TTTGACCCGGAGTTCACGTCGGAGGCGCCGCAAGACTCGTACGTAGAGGGACCGATGCTGTCGCAGACGATGCAG
AACCAGTTCCAAGGATTCAGCTACAACAGACCCATAGCGGGGCTCGGTGATGCCGGCGGCAGCGTTAAGGACCCA
TCGTTTGTGGGCAGCATGCAGGACAACCGATGA
Transcript >Hirsu2|965
ATGTCGTGGAAACTCACCAAGAAACTCAAAGAAACCCATCTCGGCCCTCTGAGCGCCTTCTCCCGATCTCCCTCC
ACCTCGACCATCACAGACAAGGACGAAAAAGCCCCCGGGGCCACGACGCCTACCTCGGAAAATGCCATCGCCGCC
TCCGAAGCCATGACCCAGAGCCCCGTCGTCAAGCCGCCGAAGCCCGGCATCCTCGTCGTCACCCTCCATGAGGGC
CAGGGCTTCTCGCTTCCCGAGCAGCATCGGAACGCCTTCGTCTCCCAGCACCAGGGCTCGCTGTCGTCAAACAAT
GCCGGCTCTATGGCCTCCTCGGTACGGCCTTCGTCCTCGCAACGCGTCGCCGGCTCCTTCATCAACGGCTCCAAC
CGGCCGCACTCGTCCGCCGGCGGCTTCGGCGGCATCCCCACCAACCACGGCCGCATCTCGGGCAAGTACATGCCC
TACGCCCTCCTCGACTTCGACAAGGTCCAGGTCTTCGTCAACTCGGTCGACGGCAACCCCGAGAACCCGCTGTGG
GCCGGCGGCAACACCCAGTACAAGTTTGACGTCTCCCGCGTCACCGAGCTCGTCATCCACCTCTACATGAGGAAC
CCCAGCGCACCCCCGAGCTCGGGCCGGAGCCAGGATATCTTCCTCGGCGTCGCCCGCATCAACCCCCGCTTCGAG
GAGCGCCAGCCGTACGTAGAGGACCCCAAGGCCAGCAAGAAGGACCGCGAGAAGGCTGCGGCCGAGCACGCCCAG
CGGCAACGGGGCGACGGCCAATGCGGCGTCGACTGGGTCGACGTCCAGTACGGCAGCGGCAAGATCAAGGTCGGC
GTTGAGTACGTCGAGACGCGCGCCGGCAAGCTCAAGATCGAGGACTTTGAGCTGCTCAAGGTCGTCGGCAAGGGC
AGCTTCGGCAAGGTGATGCAGGTGCGCAAGAAGGACACGAACCGCATCTACGCCCTCAAGACCATCCGCAAGGCC
CACATCATCTCGCGCTCCGAGGTGGCCCACACGCTGGCCGAGCGCTCCGTCCTGGCCCAGATCAACAACCCGTTC
ATCGTGCCGCTCAAGTTCAGCTTCCAGTCGCCCGAGAAGCTCTACTTCGTCCTGGCCTTTGTCAACGGCGGCGAG
CTCTTCCACCACCTGCAGAAGGAGCACCGCTTCGACGTCAACCGCTCGCGCTTCTACACGGCCGAGCTGCTGTGC
GCGCTCGAGTGTCTGCACGGCTTCAGCGTCATCTACCGCGACCTCAAGCCCGAGAACATCCTGCTCGACTACCAG
GGCCACATCGCCCTCTGCGACTTCGGCCTGTGCAAGCTCGACATGAAGGACGAGGACCGGACCAACACCTTCTGC
GGTACACCCGAGTACCTGGCGCCCGAGCTGCTGATGGGCAAGGGCTACAACAAGACGGTCGACTGGTGGACCTTG
GGCGTGCTGCTGTACGAGATGCTGACGGGCCTGCCGCCCTTTTACGACGAGAACACCAACGAGATGTACCGCAAG
ATCCTGTCGGAGCCGCTGCACTTCTCCGACGTGGTGCCGCCCGCGGCCAAGGACCTACTGACGAAGCTGCTCAAC
CGCAACCCCGAGGAGCGGCTGGGCGCCAACGGCTCGGCCGAGATCAAGGCCCACCCCTTCTTCCACGCCATCGAC
TGGCGGAAGCTGCTGCAGCGCAAGTACGAGCCGACGTTTAAGCCCAGCGTGGCGGACGCCCTGGACACGGCCAAC
TTTGACCCGGAGTTCACGTCGGAGGCGCCGCAAGACTCGTACGTAGAGGGACCGATGCTGTCGCAGACGATGCAG
AACCAGTTCCAAGGATTCAGCTACAACAGACCCATAGCGGGGCTCGGTGATGCCGGCGGCAGCGTTAAGGACCCA
TCGTTTGTGGGCAGCATGCAGGACAACCGATGA
Gene >Hirsu2|965
ATGTCGTGGAAACTCACCAAGAGTATGTGCCTCGCCTGTCGTTCCGCCCGTCCCGCCCGGGCGGCCCCCGCGCTG
ATGCCGTCGCCCGTCCCGCAGAACTCAAAGAAACCCATCTCGGCCCTCTGAGCGCCTTCTCCCGATCTCCCTCCA
CCTCGACCATCACAGACAAGGACGAAAAAGCCCCCGGGGCCACGACGCCTACCTCGGAAAATGCCATCGGTGAGC
GACCACTACCCCTCTCGCCCCTCTCGCCCCTCTCGCCCCTCTCGTCCCCCTCGTCCCCCTCGTCTCTCTCGTCGT
TCCTGAGCCCTACCTGCTTGCCTCATCGCTGACCCTCGTCTTCCAACCCTCCCCAGCCGCCTCCGAAGCCATGAC
CCAGAGCCCCGTCGTCAAGCCGCCGAAGCCCGGCATCCTCGTCGTCACCCTCCATGAGGGCCAGGGCTTCTCGCT
TCCCGAGCAGCATCGGAACGCCTTCGTCTCCCAGCACCAGGGCTCGCTGTCGTCAAACAATGCCGGCTCTATGGC
CTCCTCGGTACGGCCTTCGTCCTCGCAACGCGTCGCCGGCTCCTTCATCAACGGCTCCAACCGGCCGCACTCGTC
CGCCGGCGGCTTCGGCGGCATCCCCACCAACCACGGCCGCATCTCGGGCAAGTACATGCCCTACGCCCTCCTCGA
CTTCGACAAGGTCCAGGTCTTCGTCAACTCGGTCGACGGCAACCCCGAGAACCCGCTGTGGGCCGGCGGCAACAC
CCAGTACAAGTTTGACGTCTCCCGCGTCACCGAGCTCGTCATCCACCTCTACATGAGGAACCCCAGCGCACCCCC
GAGCTCGGGCCGGAGCCAGGATATCTTCCTCGGCGTCGCCCGCATCAACCCCCGCTTCGAGGAGCGCCAGCCGTA
CGTAGAGGACCCCAAGGCCAGCAAGAAGGACCGCGAGAAGGCTGCGGCCGAGCACGCCCAGCGGCAACGGGGCGA
CGGCCAATGCGGCGTCGACTGGGTCGACGTCCAGTACGGCAGCGGCAAGATCAAGGTCGGCGTTGAGTACGTCGA
GACGCGCGCCGGCAAGCTCAAGATCGAGGACTTTGAGCTGCTCAAGGTCGTCGGCAAGGGCAGCTTCGGCAAGGT
GATGCAGGTGCGCAAGAAGGACACGAACCGCATCTACGCCCTCAAGACCATCCGCAAGGCCCACATCATCTCGCG
CTCCGAGGTGGCCCACACGCTGGCCGAGCGCTCCGTCCTGGCCCAGATCAACAACCCGTTCATCGTGCCGCTCAA
GTTCAGCTTCCAGTCGCCCGAGAAGCTCTACTTCGTCCTGGCCTTTGTCAACGGCGGCGAGCTCTTCCACCACCT
GCAGAAGGAGCACCGCTTCGACGTCAACCGCTCGCGCTTCTACACGGCCGAGCTGCTGTGCGCGCTCGAGTGTCT
GCACGGCTTCAGCGTCATCTACCGCGACCTCAAGCCCGAGAACATCCTGCTCGACTACCAGGGCCACATCGCCCT
CTGCGACTTCGGCCTGTGCAAGCTCGACATGAAGGACGAGGACCGGACCAACACCTTCTGCGGTACACCCGAGTA
CCTGGCGCCCGAGCTGCTGATGGGCAAGGGCTACAACAAGACGGTCGACTGGTGGACCTTGGGCGTGCTGCTGTA
CGAGATGCTGACGGGCCTGCCGCCCTTTTACGACGAGAACACCAACGAGATGTACCGCAAGATCCTGTCGGAGCC
GCTGCACTTCTCCGACGTGGTGCCGCCCGCGGCCAAGGACCTACTGACGAAGCTGCTCAACCGCAACCCCGAGGA
GCGGCTGGGCGCCAACGGCTCGGCCGAGATCAAGGCCCACCCCTTCTTCCACGCCATCGACTGGCGGAAGCTGCT
GCAGCGCAAGTACGAGCCGACGTTTAAGCCCAGCGTGGTGAGTAGCCAAGCAGTGGTGGCCGTGCATCCGTCCAT
CGAACCGTTCATCTATCCACTTCCTTCACCTCGCTCTCTCCGCTCTCCGCCCTCCCCTTTCCTCTCTGCCCTCCC
CTTCCTCCCTGCTTTCCCCCTTGTCTCCCTGCTCTTCCCCTTGCCTCCCCGGACGTGTGGATGACGATGATCGGA
CCGGCGGAGTTGCTGACGCGCGACCGCAGGCGGACGCCCTGGACACGGCCAACTTTGACCCGGAGTTCACGTCGG
AGGCGCCGCAAGACTCGTACGTAGAGGGACCGATGCTGTCGCAGACGATGCAGAACCAGTTCCAAGGATTCAGCT
ACAACAGACCCATAGCGGGGCTCGGTGATGCCGGCGGCAGCGTTAAGGACCCATCGTTTGTGGGCAGCATGCAGG
ACAACCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail