Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9649
Gene name
LocationContig_714:8067..12712
Strand+
Gene length (bp)4645
Transcript length (bp)4488
Coding sequence length (bp)4488
Protein length (aa) 1496

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12859 ANAPC1 Anaphase-promoting complex subunit 1 6.1E-38 113 244

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P24686|BIME_EMENI Negative regulator of mitosis OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bimE PE=2 SV=2 1 1494 0.0E+00
sp|Q9URV2|APC1_SCHPO Anaphase-promoting complex subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut4 PE=1 SV=1 822 1494 8.0E-105
sp|Q9H1A4|APC1_HUMAN Anaphase-promoting complex subunit 1 OS=Homo sapiens GN=ANAPC1 PE=1 SV=1 866 1495 6.0E-81
sp|P53995|APC1_MOUSE Anaphase-promoting complex subunit 1 OS=Mus musculus GN=Anapc1 PE=1 SV=2 825 1495 9.0E-79
sp|P53886|APC1_YEAST Anaphase-promoting complex subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APC1 PE=1 SV=2 968 1490 9.0E-52
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P24686|BIME_EMENI Negative regulator of mitosis OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bimE PE=2 SV=2 1 1494 0.0E+00
sp|Q9URV2|APC1_SCHPO Anaphase-promoting complex subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut4 PE=1 SV=1 822 1494 8.0E-105
sp|Q9H1A4|APC1_HUMAN Anaphase-promoting complex subunit 1 OS=Homo sapiens GN=ANAPC1 PE=1 SV=1 866 1495 6.0E-81
sp|P53995|APC1_MOUSE Anaphase-promoting complex subunit 1 OS=Mus musculus GN=Anapc1 PE=1 SV=2 825 1495 9.0E-79
sp|P53886|APC1_YEAST Anaphase-promoting complex subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APC1 PE=1 SV=2 968 1490 9.0E-52
sp|Q54NC6|APC1_DICDI Anaphase-promoting complex subunit 1 OS=Dictyostelium discoideum GN=anapc1 PE=3 SV=1 1102 1433 3.0E-44
sp|Q9FFF9|APC1_ARATH Anaphase-promoting complex subunit 1 OS=Arabidopsis thaliana GN=APC1 PE=2 SV=1 869 1495 1.0E-42
sp|O18191|APC1_CAEEL Anaphase-promoting complex subunit 1 OS=Caenorhabditis elegans GN=mat-2 PE=1 SV=3 1123 1495 2.0E-32
sp|Q54NC6|APC1_DICDI Anaphase-promoting complex subunit 1 OS=Dictyostelium discoideum GN=anapc1 PE=3 SV=1 1434 1495 5.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0005680 anaphase-promoting complex Yes
GO:0044446 intracellular organelle part No
GO:0000151 ubiquitin ligase complex No
GO:1902494 catalytic complex No
GO:0044464 cell part No
GO:0032991 protein-containing complex No
GO:0000152 nuclear ubiquitin ligase complex No
GO:1990234 transferase complex No
GO:0044424 intracellular part No
GO:0031461 cullin-RING ubiquitin ligase complex No
GO:0044422 organelle part No
GO:0044428 nuclear part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9649
MASVKSLGLHQPAGLLYAVEEQLIPAGAPASSYTWDVATDLGARDHVEDELLTTRDSVVWCRGRSFRKMFKFGLE
NEPIVQALLAYFPTSEDAKTDRDTTDNTDGGSPALEKALVVFLKTQAHIYFLSGTSHILQTPFEVESACAGPVGV
IIQRRATAENVAPVSLKFPRVPPNSFVSSQLTAFTSSQQTAFSTEGLGNPKMLHLSLRSTLENMWDAPMEQPESH
WPRLVSLTDPLADIGLVVTDSDPHSHLAARKASSSRSSFLDPAEELLHIERIQLPVFCAQNLKEPLILAVTANRE
SSSYTVWRLTYLTRDDPFLSHHTKAKNKASRRRSSMQPGFASGASTPVQQTFRESFGAPLPGKRSRKSDRIDKPL
DLVSSLEQQDNDGSGVPRRSSRRVSSMLARADLSTSHERPAFVEPPLVPNAGVSKRHEHGRSSSSFHHPIHPSLG
SLLEAPVNLDEGLHNMGLDDHDFDGLQHEVRFTRIHTIPVDNSNVRYSAAAQPARSQTKVFILTAPPYAVDEQHR
TQLLVGVQDPVERRLQLTTVHVKFQERFGNITVSLSPREQWKVQNVVDSSKLVDGDLSAILVLSESMDGRHELST
QAPWIELTKISLSLLFVDDTRSLQFRGRVRDRDVKQRKSEVIDISNGSIVCIRYPRQHGVVDVVDVEGRQHQLRI
QLQPSCPQTRRALDVCKSVLAASFAGRIHAGWLHAMQWLQTKQESIVSVEWSAFATLLLASFLNLGRPESKPSQA
PRLPVRKKRSASGSFGSVREFEDWKALEAGETPNALGCPVWMMNRGWQWALDEDGDDASSAGGDQSFAPKFLATH
ITFAKEFLSSSLGETALGASGYMPLALGKTSDTRRKVAVDVFVALHLLLEEQKLDITTPEYLSPGRVDLRVLLCQ
IARWLKWHSYTSLYELGIQEDVDPRHDAELSLQTPLAQPLIRPDILGWIQSRLIGLRGQPCLTLADIYYTYTRLS
EANKLEDLRWDTITPRTLMFKRFFKLVRPKTTAVQMVEAMRNCGFTSQVLETLPEAVLAPLQDAISLCQPHPPSE
WTQDLLELVKRGDISLVLAPKKRPRVPLSSILAPTHTATWDFRLLCQSLEETNSIGYDEGEGTERQAVIRALFKD
DRRLNEAQNLLSTHKARLVRLEHNPDWPESEYLERQKELVSRIATGTLAIPAGRALLYYSLRYPLITQKFHIGGF
NLNCFVKPANVTVGVDKTLFTEEKVCWGFFHQGVAAGLAISPQAKGIDTSWILYNKPGQELSNRHAGFLLALGLN
GHLKDVAKWVAFKYLTPKHTMTSVGLLLGLAASYMGTMDSLITRLLSVHATRMLPRGAAELNLSPLTQTSGIMGI
GLLYCNSQHRRMSEIMLSEIEHVDEEDEEEPLRSECYRLAAGFALGFINLGKGSDIKGLHDMQLTEKLVAHATAT
KNVDMVHILDRAAAGAVMALALIFMKSEDQMVARKIDVPESVLQFDYVRPDILLLRTVTKNLILWSKVEP*
Coding >Hirsu2|9649
ATGGCCTCGGTCAAGTCCCTGGGGCTGCACCAGCCGGCAGGACTTCTGTACGCGGTCGAAGAGCAGCTGATACCC
GCCGGCGCACCCGCTTCTTCCTACACCTGGGACGTTGCGACCGACCTCGGCGCGCGGGACCATGTCGAGGACGAG
CTGTTGACGACTCGCGATAGTGTCGTCTGGTGTCGCGGACGGAGCTTTCGCAAGATGTTCAAGTTTGGCCTTGAA
AATGAACCAATTGTTCAAGCGCTCCTCGCTTATTTCCCAACCTCGGAAGACGCAAAGACCGACCGCGACACGACC
GACAACACCGACGGCGGCTCGCCCGCGCTCGAGAAAGCTCTCGTCGTCTTCCTCAAGACCCAGGCTCACATCTAC
TTCCTTTCGGGAACCAGCCACATCCTCCAAACCCCCTTCGAGGTCGAGTCCGCCTGTGCTGGTCCCGTCGGCGTC
ATCATTCAGCGAAGAGCAACAGCGGAAAATGTGGCCCCGGTCTCTCTCAAGTTTCCCCGTGTTCCGCCAAACTCC
TTCGTCTCGTCGCAGCTCACCGCCTTCACAAGCTCCCAGCAGACCGCCTTCTCGACCGAAGGCCTGGGAAATCCA
AAAATGCTCCACCTGAGCCTGAGGTCAACGCTCGAGAACATGTGGGATGCGCCTATGGAGCAGCCCGAATCCCAC
TGGCCGCGCCTCGTCTCCTTGACAGACCCGCTGGCCGACATTGGTTTGGTTGTGACTGACTCTGATCCTCACAGC
CATCTGGCCGCACGGAAAGCGTCGTCTTCGAGGTCGTCCTTTTTGGATCCGGCAGAGGAGCTCCTGCACATCGAA
CGCATCCAGCTACCCGTCTTTTGCGCCCAGAATCTCAAGGAACCGCTCATCCTTGCCGTCACGGCGAACCGCGAA
AGCAGCTCCTACACAGTATGGCGGCTGACCTATCTCACGCGCGACGATCCCTTTCTCAGCCACCACACAAAGGCC
AAGAACAAGGCGTCCCGCCGCCGAAGCTCCATGCAGCCGGGGTTTGCCAGCGGTGCCTCGACGCCCGTTCAACAA
ACCTTTCGCGAGAGCTTCGGAGCCCCTCTGCCGGGGAAGCGTTCCCGGAAAAGCGACAGGATCGACAAGCCGCTG
GATCTGGTTTCGTCTCTGGAACAGCAGGACAACGACGGCTCGGGTGTTCCGCGGAGGAGCTCTCGCAGAGTAAGC
TCCATGTTGGCCCGAGCGGACCTCTCAACTTCTCACGAGCGGCCAGCCTTCGTCGAGCCGCCACTCGTACCCAAC
GCCGGCGTGTCCAAACGGCATGAACATGGACGATCGAGCTCGAGCTTCCATCACCCCATCCACCCCAGCCTCGGC
AGCCTGCTCGAGGCGCCCGTCAACCTCGACGAGGGGCTCCATAACATGGGCCTCGATGATCACGACTTCGACGGC
TTGCAGCACGAGGTCCGGTTCACGAGGATTCACACAATCCCGGTCGACAACTCCAACGTGCGGTATTCTGCGGCA
GCGCAGCCGGCTCGCAGCCAGACCAAAGTCTTCATCCTCACTGCGCCGCCGTACGCCGTCGACGAGCAGCACCGT
ACCCAGCTTCTCGTTGGCGTCCAGGATCCCGTCGAGAGACGACTCCAGCTGACAACGGTTCATGTCAAATTTCAA
GAAAGGTTTGGCAACATCACCGTCTCACTCTCGCCCCGGGAGCAGTGGAAAGTGCAGAACGTGGTCGACTCCTCG
AAGCTGGTCGACGGCGACCTCTCGGCCATTCTAGTCCTTTCCGAGTCTATGGACGGACGCCATGAGCTGAGCACC
CAGGCCCCGTGGATCGAATTGACCAAGATTTCTCTGTCTCTTTTATTCGTCGACGACACGAGGAGCCTGCAATTT
CGCGGTAGAGTGCGGGATCGAGACGTTAAGCAGAGGAAGTCGGAGGTCATAGACATCAGCAATGGCAGCATCGTT
TGCATCCGTTACCCTCGACAACATGGAGTTGTCGACGTTGTGGACGTGGAGGGGCGCCAACATCAATTAAGGATC
CAGCTGCAGCCCTCGTGCCCTCAAACACGAAGGGCTTTGGATGTCTGCAAAAGCGTCCTGGCGGCTTCTTTTGCG
GGTCGCATACATGCCGGGTGGCTGCATGCCATGCAGTGGCTTCAGACCAAGCAAGAGTCTATCGTCAGCGTCGAG
TGGTCTGCATTCGCCACCTTACTTCTGGCTTCCTTTCTCAATCTGGGGCGCCCCGAATCCAAGCCCTCCCAGGCG
CCGCGTCTGCCAGTCCGCAAGAAGAGATCGGCGTCTGGCTCCTTCGGGTCCGTACGAGAGTTCGAAGACTGGAAG
GCGCTGGAAGCCGGCGAGACGCCGAACGCTTTGGGCTGCCCCGTCTGGATGATGAACAGAGGGTGGCAGTGGGCT
CTGGACGAGGATGGCGACGACGCTTCGTCTGCCGGGGGCGATCAAAGCTTTGCCCCCAAGTTCCTCGCCACGCAC
ATTACCTTTGCGAAGGAGTTCCTGTCCTCGTCGCTAGGCGAGACCGCTCTGGGTGCCTCGGGCTACATGCCGCTG
GCCTTGGGCAAGACCTCTGACACTCGTCGCAAGGTTGCTGTGGACGTCTTTGTGGCCTTACACTTGCTCCTCGAG
GAGCAAAAACTCGATATTACGACGCCTGAGTACCTCTCTCCGGGAAGAGTCGATTTGAGGGTCCTGCTCTGCCAA
ATTGCCAGATGGCTCAAGTGGCATAGTTATACGTCTCTATATGAGCTTGGCATCCAGGAAGATGTCGATCCACGC
CACGACGCGGAACTCAGTCTACAAACACCGCTCGCACAGCCGCTGATAAGACCGGACATCCTTGGATGGATCCAA
TCTCGACTTATTGGCCTTCGTGGACAGCCCTGTCTGACGTTGGCGGACATCTACTATACCTATACGCGACTATCC
GAGGCCAACAAACTGGAGGATCTTCGTTGGGATACAATCACGCCCCGGACGCTCATGTTCAAAAGGTTCTTCAAG
CTGGTGAGGCCTAAGACGACGGCGGTCCAGATGGTGGAGGCCATGAGAAATTGCGGCTTTACCAGCCAAGTGCTG
GAAACGCTACCGGAAGCCGTCTTGGCTCCTCTGCAGGATGCCATATCTCTTTGCCAGCCCCACCCGCCCTCCGAA
TGGACACAGGATTTGTTGGAACTGGTGAAGCGGGGCGACATCAGCCTTGTGCTTGCGCCTAAGAAGCGCCCTCGC
GTTCCCTTGTCTAGCATTCTGGCTCCCACGCACACGGCCACATGGGACTTCCGACTCCTTTGCCAAAGCCTGGAG
GAGACAAACAGCATCGGGTACGACGAGGGTGAGGGCACAGAGCGCCAGGCTGTCATCCGAGCCCTGTTCAAGGAT
GACCGTCGGCTCAACGAGGCACAAAACCTGCTGTCTACCCACAAGGCGAGGCTGGTTCGCTTGGAGCACAATCCG
GATTGGCCGGAAAGCGAATATCTGGAGAGACAAAAGGAACTCGTTTCGCGGATTGCCACGGGCACACTGGCCATC
CCGGCCGGGCGGGCGTTGCTATACTATAGTCTACGATACCCCCTCATCACCCAAAAGTTCCACATCGGAGGCTTC
AACCTCAACTGCTTCGTGAAGCCGGCCAACGTGACGGTCGGCGTCGACAAAACGCTGTTCACGGAAGAAAAGGTC
TGCTGGGGCTTCTTCCACCAGGGAGTCGCCGCTGGTTTGGCCATCTCGCCTCAGGCAAAGGGCATCGACACGTCG
TGGATCCTTTACAACAAGCCGGGACAGGAGCTGAGCAACCGGCACGCCGGCTTCCTGCTCGCCCTCGGTCTCAAC
GGGCACCTCAAGGATGTCGCGAAATGGGTCGCTTTTAAGTATCTCACGCCAAAGCACACCATGACGTCGGTCGGA
CTGCTCCTCGGGCTGGCGGCCTCTTACATGGGCACCATGGACTCGCTCATCACCCGCCTCCTGTCGGTGCACGCC
ACGCGCATGCTACCGCGCGGGGCCGCGGAACTGAACCTGTCGCCGCTCACGCAGACCTCGGGCATAATGGGCATC
GGGCTGCTGTACTGCAACAGCCAGCACCGACGGATGAGCGAGATCATGCTGTCGGAGATTGAGCACGTGGACGAG
GAGGACGAGGAGGAGCCGCTTAGGAGCGAATGCTACCGGCTGGCCGCGGGATTCGCGCTGGGATTCATCAACCTC
GGCAAGGGGAGCGACATCAAGGGCCTCCACGACATGCAGCTGACGGAGAAGCTGGTGGCGCACGCCACGGCCACG
AAGAACGTCGACATGGTCCACATCCTCGACAGGGCCGCAGCCGGTGCCGTCATGGCCCTCGCGCTCATCTTCATG
AAGTCGGAGGACCAGATGGTGGCCCGCAAGATTGACGTGCCGGAGTCGGTCCTCCAGTTCGACTACGTGCGGCCC
GACATTCTGCTCCTGCGGACCGTCACCAAGAACCTGATCCTGTGGTCCAAGGTGGAGCCCTGA
Transcript >Hirsu2|9649
ATGGCCTCGGTCAAGTCCCTGGGGCTGCACCAGCCGGCAGGACTTCTGTACGCGGTCGAAGAGCAGCTGATACCC
GCCGGCGCACCCGCTTCTTCCTACACCTGGGACGTTGCGACCGACCTCGGCGCGCGGGACCATGTCGAGGACGAG
CTGTTGACGACTCGCGATAGTGTCGTCTGGTGTCGCGGACGGAGCTTTCGCAAGATGTTCAAGTTTGGCCTTGAA
AATGAACCAATTGTTCAAGCGCTCCTCGCTTATTTCCCAACCTCGGAAGACGCAAAGACCGACCGCGACACGACC
GACAACACCGACGGCGGCTCGCCCGCGCTCGAGAAAGCTCTCGTCGTCTTCCTCAAGACCCAGGCTCACATCTAC
TTCCTTTCGGGAACCAGCCACATCCTCCAAACCCCCTTCGAGGTCGAGTCCGCCTGTGCTGGTCCCGTCGGCGTC
ATCATTCAGCGAAGAGCAACAGCGGAAAATGTGGCCCCGGTCTCTCTCAAGTTTCCCCGTGTTCCGCCAAACTCC
TTCGTCTCGTCGCAGCTCACCGCCTTCACAAGCTCCCAGCAGACCGCCTTCTCGACCGAAGGCCTGGGAAATCCA
AAAATGCTCCACCTGAGCCTGAGGTCAACGCTCGAGAACATGTGGGATGCGCCTATGGAGCAGCCCGAATCCCAC
TGGCCGCGCCTCGTCTCCTTGACAGACCCGCTGGCCGACATTGGTTTGGTTGTGACTGACTCTGATCCTCACAGC
CATCTGGCCGCACGGAAAGCGTCGTCTTCGAGGTCGTCCTTTTTGGATCCGGCAGAGGAGCTCCTGCACATCGAA
CGCATCCAGCTACCCGTCTTTTGCGCCCAGAATCTCAAGGAACCGCTCATCCTTGCCGTCACGGCGAACCGCGAA
AGCAGCTCCTACACAGTATGGCGGCTGACCTATCTCACGCGCGACGATCCCTTTCTCAGCCACCACACAAAGGCC
AAGAACAAGGCGTCCCGCCGCCGAAGCTCCATGCAGCCGGGGTTTGCCAGCGGTGCCTCGACGCCCGTTCAACAA
ACCTTTCGCGAGAGCTTCGGAGCCCCTCTGCCGGGGAAGCGTTCCCGGAAAAGCGACAGGATCGACAAGCCGCTG
GATCTGGTTTCGTCTCTGGAACAGCAGGACAACGACGGCTCGGGTGTTCCGCGGAGGAGCTCTCGCAGAGTAAGC
TCCATGTTGGCCCGAGCGGACCTCTCAACTTCTCACGAGCGGCCAGCCTTCGTCGAGCCGCCACTCGTACCCAAC
GCCGGCGTGTCCAAACGGCATGAACATGGACGATCGAGCTCGAGCTTCCATCACCCCATCCACCCCAGCCTCGGC
AGCCTGCTCGAGGCGCCCGTCAACCTCGACGAGGGGCTCCATAACATGGGCCTCGATGATCACGACTTCGACGGC
TTGCAGCACGAGGTCCGGTTCACGAGGATTCACACAATCCCGGTCGACAACTCCAACGTGCGGTATTCTGCGGCA
GCGCAGCCGGCTCGCAGCCAGACCAAAGTCTTCATCCTCACTGCGCCGCCGTACGCCGTCGACGAGCAGCACCGT
ACCCAGCTTCTCGTTGGCGTCCAGGATCCCGTCGAGAGACGACTCCAGCTGACAACGGTTCATGTCAAATTTCAA
GAAAGGTTTGGCAACATCACCGTCTCACTCTCGCCCCGGGAGCAGTGGAAAGTGCAGAACGTGGTCGACTCCTCG
AAGCTGGTCGACGGCGACCTCTCGGCCATTCTAGTCCTTTCCGAGTCTATGGACGGACGCCATGAGCTGAGCACC
CAGGCCCCGTGGATCGAATTGACCAAGATTTCTCTGTCTCTTTTATTCGTCGACGACACGAGGAGCCTGCAATTT
CGCGGTAGAGTGCGGGATCGAGACGTTAAGCAGAGGAAGTCGGAGGTCATAGACATCAGCAATGGCAGCATCGTT
TGCATCCGTTACCCTCGACAACATGGAGTTGTCGACGTTGTGGACGTGGAGGGGCGCCAACATCAATTAAGGATC
CAGCTGCAGCCCTCGTGCCCTCAAACACGAAGGGCTTTGGATGTCTGCAAAAGCGTCCTGGCGGCTTCTTTTGCG
GGTCGCATACATGCCGGGTGGCTGCATGCCATGCAGTGGCTTCAGACCAAGCAAGAGTCTATCGTCAGCGTCGAG
TGGTCTGCATTCGCCACCTTACTTCTGGCTTCCTTTCTCAATCTGGGGCGCCCCGAATCCAAGCCCTCCCAGGCG
CCGCGTCTGCCAGTCCGCAAGAAGAGATCGGCGTCTGGCTCCTTCGGGTCCGTACGAGAGTTCGAAGACTGGAAG
GCGCTGGAAGCCGGCGAGACGCCGAACGCTTTGGGCTGCCCCGTCTGGATGATGAACAGAGGGTGGCAGTGGGCT
CTGGACGAGGATGGCGACGACGCTTCGTCTGCCGGGGGCGATCAAAGCTTTGCCCCCAAGTTCCTCGCCACGCAC
ATTACCTTTGCGAAGGAGTTCCTGTCCTCGTCGCTAGGCGAGACCGCTCTGGGTGCCTCGGGCTACATGCCGCTG
GCCTTGGGCAAGACCTCTGACACTCGTCGCAAGGTTGCTGTGGACGTCTTTGTGGCCTTACACTTGCTCCTCGAG
GAGCAAAAACTCGATATTACGACGCCTGAGTACCTCTCTCCGGGAAGAGTCGATTTGAGGGTCCTGCTCTGCCAA
ATTGCCAGATGGCTCAAGTGGCATAGTTATACGTCTCTATATGAGCTTGGCATCCAGGAAGATGTCGATCCACGC
CACGACGCGGAACTCAGTCTACAAACACCGCTCGCACAGCCGCTGATAAGACCGGACATCCTTGGATGGATCCAA
TCTCGACTTATTGGCCTTCGTGGACAGCCCTGTCTGACGTTGGCGGACATCTACTATACCTATACGCGACTATCC
GAGGCCAACAAACTGGAGGATCTTCGTTGGGATACAATCACGCCCCGGACGCTCATGTTCAAAAGGTTCTTCAAG
CTGGTGAGGCCTAAGACGACGGCGGTCCAGATGGTGGAGGCCATGAGAAATTGCGGCTTTACCAGCCAAGTGCTG
GAAACGCTACCGGAAGCCGTCTTGGCTCCTCTGCAGGATGCCATATCTCTTTGCCAGCCCCACCCGCCCTCCGAA
TGGACACAGGATTTGTTGGAACTGGTGAAGCGGGGCGACATCAGCCTTGTGCTTGCGCCTAAGAAGCGCCCTCGC
GTTCCCTTGTCTAGCATTCTGGCTCCCACGCACACGGCCACATGGGACTTCCGACTCCTTTGCCAAAGCCTGGAG
GAGACAAACAGCATCGGGTACGACGAGGGTGAGGGCACAGAGCGCCAGGCTGTCATCCGAGCCCTGTTCAAGGAT
GACCGTCGGCTCAACGAGGCACAAAACCTGCTGTCTACCCACAAGGCGAGGCTGGTTCGCTTGGAGCACAATCCG
GATTGGCCGGAAAGCGAATATCTGGAGAGACAAAAGGAACTCGTTTCGCGGATTGCCACGGGCACACTGGCCATC
CCGGCCGGGCGGGCGTTGCTATACTATAGTCTACGATACCCCCTCATCACCCAAAAGTTCCACATCGGAGGCTTC
AACCTCAACTGCTTCGTGAAGCCGGCCAACGTGACGGTCGGCGTCGACAAAACGCTGTTCACGGAAGAAAAGGTC
TGCTGGGGCTTCTTCCACCAGGGAGTCGCCGCTGGTTTGGCCATCTCGCCTCAGGCAAAGGGCATCGACACGTCG
TGGATCCTTTACAACAAGCCGGGACAGGAGCTGAGCAACCGGCACGCCGGCTTCCTGCTCGCCCTCGGTCTCAAC
GGGCACCTCAAGGATGTCGCGAAATGGGTCGCTTTTAAGTATCTCACGCCAAAGCACACCATGACGTCGGTCGGA
CTGCTCCTCGGGCTGGCGGCCTCTTACATGGGCACCATGGACTCGCTCATCACCCGCCTCCTGTCGGTGCACGCC
ACGCGCATGCTACCGCGCGGGGCCGCGGAACTGAACCTGTCGCCGCTCACGCAGACCTCGGGCATAATGGGCATC
GGGCTGCTGTACTGCAACAGCCAGCACCGACGGATGAGCGAGATCATGCTGTCGGAGATTGAGCACGTGGACGAG
GAGGACGAGGAGGAGCCGCTTAGGAGCGAATGCTACCGGCTGGCCGCGGGATTCGCGCTGGGATTCATCAACCTC
GGCAAGGGGAGCGACATCAAGGGCCTCCACGACATGCAGCTGACGGAGAAGCTGGTGGCGCACGCCACGGCCACG
AAGAACGTCGACATGGTCCACATCCTCGACAGGGCCGCAGCCGGTGCCGTCATGGCCCTCGCGCTCATCTTCATG
AAGTCGGAGGACCAGATGGTGGCCCGCAAGATTGACGTGCCGGAGTCGGTCCTCCAGTTCGACTACGTGCGGCCC
GACATTCTGCTCCTGCGGACCGTCACCAAGAACCTGATCCTGTGGTCCAAGGTGGAGCCCTGA
Gene >Hirsu2|9649
ATGGCCTCGGTCAAGTCCCTGGGGCTGCACCAGCCGGCAGGACTTCTGTACGCGGTCGAAGAGCAGCTGATACCC
GCCGGCGCACCCGCTTCTTCCTACACCTGGGACGTTGCGACCGACCTCGGCGCGCGGGACCATGTCGAGGACGAG
CTGTTGACGACTCGCGATAGTGTCGTCTGGTGTCGCGGACGGAGCTTTCGCAAGATGTTCAAGTTTGGCCTTGAA
AATGAACCAATTGTTCAAGCGCTCCTCGCTTATTTCCCAACCTCGGAAGACGCAAAGACCGACCGCGACACGACC
GACAACACCGACGGCGGCTCGCCCGCGCTCGAGAAAGCTCTCGTCGTCTTCCTCAAGACCCAGGCTCACATCTAC
TTCCTTTCGGGAACCAGCCACATCCTCCAAACCCCCTTCGAGGTCGAGTCCGCCTGTGCTGGTCCCGTCGGCGTC
ATCATTCAGCGAAGAGCAACAGCGGAAAATGTGGCCCCGGTCTCTCTCAAGTTTCCCCGTGTTCCGCCAAACTCC
TTCGTCTCGTCGCAGCTCACCGCCTTCACAAGCTCCCAGCAGACCGCCTTCTCGACCGAAGGCCTGGGAAATCCA
AAAATGCTCCACCTGAGCCTGAGGTCAACGCTCGAGAACATGTGGGATGCGCCTATGGAGCAGCCCGAATCCCAC
TGGCCGCGCCTCGTCTCCTTGACAGACCCGCTGGCCGACATTGGTTTGGTTGTGACTGACTCTGATCCTCACAGC
CATCTGGCCGCACGGAAAGCGTCGTCTTCGAGGTCGTCCTTTTTGGATCCGGCAGAGGAGCTCCTGCACATCGAA
CGCATCCAGCTACCCGTCTTTTGCGCCCAGAATCTCAAGGAACCGCTCATCCTTGCCGTCACGGCGAACCGCGAA
AGCAGCTCCTACACAGTATGGCGGCTGACCTATCTCACGCGCGACGATCCCTTTCTCAGCCACCACACAAAGGCC
AAGAACAAGGCGTCCCGCCGCCGAAGCTCCATGCAGCCGGGGTTTGCCAGCGGTGCCTCGACGCCCGTTCAACAA
ACCTTTCGCGAGAGCTTCGGAGCCCCTCTGCCGGGGAAGCGTTCCCGGAAAAGCGACAGGATCGACAAGCCGCTG
GATCTGGTTTCGTCTCTGGAACAGCAGGACAACGACGGCTCGGGTGTTCCGCGGAGGAGCTCTCGCAGAGTAAGC
TCCATGTTGGCCCGAGCGGACCTCTCAACTTCTCACGAGCGGCCAGCCTTCGTCGAGCCGCCACTCGTACCCAAC
GCCGGCGTGTCCAAACGGCATGAACATGGACGATCGAGCTCGAGCTTCCATCACCCCATCCACCCCAGCCTCGGC
AGCCTGCTCGAGGCGCCCGTCAACCTCGACGAGGGGCTCCATAACATGGGCCTCGATGATCACGACTTCGACGGC
TTGCAGCACGAGGTCCGGTTCACGAGGATTCACACAATCCCGGTCGACAACTCCAACGTGCGGTATTCTGCGGCA
GCGCAGCCGGCTCGCAGCCAGACCAAAGTCTTCATCCTCACTGCGCCGCCGTACGCCGTCGACGAGCAGCACCGT
ACCCAGCTTCTCGTTGGCGTCCAGGATCCCGTCGAGAGACGACTCCAGCTGACAACGGTTCATGTCAAATTTCAA
GAAAGGTTTGGCAACATCACCGTCTCACTCTCGCCCCGGGAGCAGTGGAAAGTGCAGAACGTGGTCGACTCCTCG
AAGCTGGTCGACGGCGACCTCTCGGCCATTCTAGTCCTTTCCGAGTCTATGGACGGACGCCATGAGCTGAGCACC
CAGGCCCCGTGGATCGAATTGACCAAGATTTCTCTGTCTCTTTTATTCGTCGACGACACGAGGAGCCTGCAATTT
CGCGGTAGAGTGCGGGATCGAGACGTTAAGCAGAGGAAGTCGGAGGTCATAGACATCAGCAATGGCAGCATCGTT
TGCATCCGTTACCCTCGACAACATGGAGTTGTCGACGTTGTGGACGTGGAGGGGCGCCAACATCAATTAAGGATC
CAGCTGCAGCCCTCGTGCCCTCAAACACGAAGGGCTTTGGATGTCTGCAAAAGCGTCCTGGCGGCTTCTTTTGCG
GGTCGCATACATGCCGGGTGGCTGCATGCCATGCAGTGGCTTCAGACCAAGCAAGAGTCTATCGTCAGCGTCGAG
TGGTCTGCATTCGCCACCTTACTTCTGGCTTCCTTTCTCAATCTGGGGCGCCCCGAATCCAAGCCCTCCCAGGCG
CCGCGTCTGCCAGTCCGCAAGAAGAGATCGGCGTCTGGCTCCTTCGGGTCCGTACGAGAGTTCGAAGACTGGAAG
GCGCTGGAAGCCGGCGAGACGCCGAACGCTTTGGGCTGCCCCGTCTGGATGATGAACAGAGGGTGGCAGTGGGCT
CTGGACGAGGATGGCGACGACGCTTCGTCTGCCGGGGGCGATCAAAGCTTTGCCCCCAAGTTCCTCGCCACGCAC
ATTACCTTTGCGAAGGAGTTCCTGTCCTCGTCGCTAGGCGAGACCGCTCTGGGTGCCTCGGGCTACATGCCGCTG
GCCTTGGGCAAGACCTCTGACACTCGTCGCAAGGTTGCTGTGGACGTCTTTGTGGCCTTACACTTGCTCCTCGAG
GAGCAAAAACTCGATATTACGACGCCTGAGTACCTCTCTCCGGGAAGAGTCGATTTGAGGGTCCTGCTCTGCCAA
ATTGCCAGATGGCTCAAGTGGCATAGTTATACGTCTCTATATGAGCTTGGCATCCAGGAAGATGTCGATCCACGC
CACGACGCGGGTGAGTAACCTTCGTAACAAGATCGTATGCGTGCGGAGCTGATGGACCATCAGAACTCAGTCTAC
AAACACCGCTCGCACAGCCGCTGATAAGACCGGACATCCTTGGATGGATCCAATCTCGACTTATTGGCCTTCGTG
GACAGCCCTGTCTGACGTTGGCGGACATCTACTATACCTATACGCGACTATCCGAGGCCAACAAACTGGAGGATC
TTCGTTGGGATACAATCACGCCCCGGACGCTCATGTTCAAAAGGTTCTTCAAGCTGGTGAGGCCTAAGACGACGG
CGGTCCAGATGGTGGAGGCCATGAGAAATTGCGGCTTTACCAGCCAAGTGCTGGAAACGCTACCGGAAGCCGTCT
TGGCTCCTCTGCAGGATGCCATATCTCTTTGCCAGCCCCACCCGCCCTCCGAATGGACACAGGATTTGTTGGAAC
TGGTGAAGCGGGGCGACATCAGCCTTGTGCTTGCGCCTAAGAAGCGCCCTCGCGTTCCCTTGTCTAGCATTCTGG
TAAGTGGATTCGATCGGCTTCTCAACGGACCTTGCTCACTGAAAATAGGCTCCCACGCACACGGCCACATGGGAC
TTCCGACTCCTTTGCCAAAGCCTGGAGGAGACAAACAGCATCGGGTACGACGAGGGTGAGGGCACAGAGCGCCAG
GCTGTCATCCGAGCCCTGTTCAAGGATGACCGTCGGCTCAACGAGGCACAAAACCTGCTGTCTACCCACAAGGCG
AGGCTGGTTCGCTTGGAGCACAATCCGGATTGGCCGGAAAGCGAATATCTGGAGAGACAAAAGGAACTCGTTTCG
CGGATTGCCACGGGCACACTGGCCATCCCGGCCGGGCGGGCGTTGCTATACTATAGTCTACGATACCCCCTCATC
ACCCAAAAGTTCCACATCGGAGGCTTCAACCTCAACTGCTTCGTGAAGCCGGCCAACGTGACGGTCGGCGTCGAC
AAAACGCTGTTCACGGAAGAAAAGGTCTGCTGGGGCTTCTTCCACCAGGGAGTCGCCGCTGGTTTGGCCATCTCG
CCTCAGGCAAAGGGCATCGACACGTCGTGGATCCTTTACAACAAGCCGGGACAGGAGCTGAGCAACCGGCACGCC
GGCTTCCTGCTCGCCCTCGGTCTCAACGGGCACCTCAAGGATGTCGCGAAATGGGTCGCTTTTAAGTATCTCACG
CCAAAGCACACCATGACGTCGGTCGGACTGCTCCTCGGGCTGGCGGCCTCTTACATGGGCACCATGGACTCGCTC
ATCACCCGCCTCCTGTCGGTGCACGCCACGCGCATGCTACCGCGCGGGGCCGCGGAACTGAACCTGTCGCCGCTC
ACGCAGACCTCGGGCATAATGGGCATCGGGCTGCTGTACTGCAACAGCCAGCACCGACGGATGAGCGAGATCATG
CTGTCGGAGATTGAGCACGTGGACGAGGAGGACGAGGAGGAGCCGCTTAGGAGCGAATGCTACCGGCTGGCCGCG
GGATTCGCGCTGGGATTCATCAACCTCGGCAAGGGGAGCGACATCAAGGGCCTCCACGACATGCAGCTGACGGAG
AAGCTGGTGGCGCACGCCACGGCCACGAAGAACGTCGACATGGTCCACATCCTCGACAGGGCCGCAGCCGGTGCC
GTCATGGCCCTCGCGCTCATCTTCATGAAGTCGGAGGACCAGATGGTGGCCCGCAAGATTGACGTGCCGGAGTCG
GTCCTCCAGTTCGACTACGTGCGGCCCGACATTCTGCTCCTGCGGACCGTCACCAAGAACCTGATCCTGTGGTCC
AAGGTGGAGCCGTCCCTCGGCTGGATACACGACAACCTGCCGGCGCCGTACCGCGCCGGATACAAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail