Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9634
Gene name
LocationContig_711:9493..10039
Strand-
Gene length (bp)546
Transcript length (bp)546
Coding sequence length (bp)546
Protein length (aa) 182

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05207 zf-CSL CSL zinc finger 8.8E-17 105 164
PF00226 DnaJ DnaJ domain 4.8E-10 13 83

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I7G0|DPH4_GIBZE Diphthamide biosynthesis protein 4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DPH4 PE=3 SV=2 11 179 7.0E-57
sp|Q7SEK8|DPH4_NEUCR Diphthamide biosynthesis protein 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dph-4 PE=3 SV=1 13 165 2.0E-31
sp|Q4WPF7|DPH4_ASPFU Diphthamide biosynthesis protein 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dph4 PE=3 SV=1 24 170 2.0E-28
sp|P0C0V5|DPH4_EMENI Diphthamide biosynthesis protein 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dph4 PE=3 SV=1 13 168 4.0E-28
sp|Q752D7|DPH4_ASHGO Diphthamide biosynthesis protein 4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DPH4 PE=3 SV=1 13 166 2.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I7G0|DPH4_GIBZE Diphthamide biosynthesis protein 4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DPH4 PE=3 SV=2 11 179 7.0E-57
sp|Q7SEK8|DPH4_NEUCR Diphthamide biosynthesis protein 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dph-4 PE=3 SV=1 13 165 2.0E-31
sp|Q4WPF7|DPH4_ASPFU Diphthamide biosynthesis protein 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dph4 PE=3 SV=1 24 170 2.0E-28
sp|P0C0V5|DPH4_EMENI Diphthamide biosynthesis protein 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dph4 PE=3 SV=1 13 168 4.0E-28
sp|Q752D7|DPH4_ASHGO Diphthamide biosynthesis protein 4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DPH4 PE=3 SV=1 13 166 2.0E-19
sp|Q6FWM1|DPH4_CANGA Diphthamide biosynthesis protein 4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DPH4 PE=3 SV=1 13 169 4.0E-17
sp|Q6C6T1|DPH4_YARLI Diphthamide biosynthesis protein 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DPH4 PE=3 SV=1 14 168 1.0E-16
sp|Q5AD49|DPH4_CANAL Diphthamide biosynthesis protein 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=JJJ3 PE=3 SV=1 13 163 2.0E-15
sp|Q6BPC1|DPH4_DEBHA Diphthamide biosynthesis protein 4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DPH4 PE=3 SV=1 5 169 3.0E-15
sp|P47138|DPH4_YEAST Diphthamide biosynthesis protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=JJJ3 PE=1 SV=1 11 169 8.0E-15
sp|Q9UUG3|DPH4_SCHPO Diphthamide biosynthesis protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dph4 PE=3 SV=1 13 165 1.0E-12
sp|Q7ZXQ8|DJB14_XENLA DnaJ homolog subfamily B member 14 OS=Xenopus laevis GN=dnajb14 PE=2 SV=1 13 85 5.0E-07
sp|O34136|DNAJ_DEIPM Chaperone protein DnaJ OS=Deinococcus proteolyticus (strain ATCC 35074 / DSM 20540 / JCM 6276 / NBRC 101906 / NCIMB 13154 / VKM Ac-1939 / CCM 2703 / MRP) GN=dnaJ PE=3 SV=2 14 83 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9634
MAAREDGDQPAATHYEVLGLSPAMLDAPAAREPSPLVKQAYRRALLRNHPDKKSGGARPAFTVDQIGLALAVLSS
PARRAAYDASLRLSRAAPAPATRLPTGVENADLDDLAFDEAEGRWHRSCRCGNARGYCFDEADLTDAADEGLLMV
GCQDCSLWLRVHFAVVDDEGPVASTNSNDGS*
Coding >Hirsu2|9634
ATGGCCGCCCGCGAAGACGGCGACCAGCCGGCGGCGACGCACTACGAGGTGCTCGGCCTCAGCCCGGCGATGCTC
GACGCCCCGGCCGCGCGCGAGCCGTCGCCGCTCGTGAAGCAGGCCTACCGCCGCGCCCTGCTGCGCAACCACCCC
GACAAGAAGAGCGGCGGCGCGCGGCCGGCCTTCACCGTCGACCAGATCGGCCTGGCCCTGGCCGTGCTGTCGTCC
CCCGCCCGTCGCGCCGCCTACGACGCCTCGCTCCGGCTCTCGCGCGCCGCCCCCGCCCCCGCCACCCGGCTCCCG
ACGGGCGTCGAGAACGCCGACCTCGACGACCTCGCGTTCGACGAGGCCGAGGGCCGCTGGCATCGCTCCTGTCGC
TGCGGCAACGCCCGTGGCTACTGCTTCGACGAGGCCGACCTGACGGACGCCGCCGATGAGGGGCTGCTCATGGTG
GGCTGCCAGGACTGTAGTCTCTGGCTGAGGGTCCACTTCGCCGTTGTAGACGACGAAGGGCCCGTCGCATCAACG
AATTCCAACGACGGAAGCTGA
Transcript >Hirsu2|9634
ATGGCCGCCCGCGAAGACGGCGACCAGCCGGCGGCGACGCACTACGAGGTGCTCGGCCTCAGCCCGGCGATGCTC
GACGCCCCGGCCGCGCGCGAGCCGTCGCCGCTCGTGAAGCAGGCCTACCGCCGCGCCCTGCTGCGCAACCACCCC
GACAAGAAGAGCGGCGGCGCGCGGCCGGCCTTCACCGTCGACCAGATCGGCCTGGCCCTGGCCGTGCTGTCGTCC
CCCGCCCGTCGCGCCGCCTACGACGCCTCGCTCCGGCTCTCGCGCGCCGCCCCCGCCCCCGCCACCCGGCTCCCG
ACGGGCGTCGAGAACGCCGACCTCGACGACCTCGCGTTCGACGAGGCCGAGGGCCGCTGGCATCGCTCCTGTCGC
TGCGGCAACGCCCGTGGCTACTGCTTCGACGAGGCCGACCTGACGGACGCCGCCGATGAGGGGCTGCTCATGGTG
GGCTGCCAGGACTGTAGTCTCTGGCTGAGGGTCCACTTCGCCGTTGTAGACGACGAAGGGCCCGTCGCATCAACG
AATTCCAACGACGGAAGCTGA
Gene >Hirsu2|9634
ATGGCCGCCCGCGAAGACGGCGACCAGCCGGCGGCGACGCACTACGAGGTGCTCGGCCTCAGCCCGGCGATGCTC
GACGCCCCGGCCGCGCGCGAGCCGTCGCCGCTCGTGAAGCAGGCCTACCGCCGCGCCCTGCTGCGCAACCACCCC
GACAAGAAGAGCGGCGGCGCGCGGCCGGCCTTCACCGTCGACCAGATCGGCCTGGCCCTGGCCGTGCTGTCGTCC
CCCGCCCGTCGCGCCGCCTACGACGCCTCGCTCCGGCTCTCGCGCGCCGCCCCCGCCCCCGCCACCCGGCTCCCG
ACGGGCGTCGAGAACGCCGACCTCGACGACCTCGCGTTCGACGAGGCCGAGGGCCGCTGGCATCGCTCCTGTCGC
TGCGGCAACGCCCGTGGCTACTGCTTCGACGAGGCCGACCTGACGGACGCCGCCGATGAGGGGCTGCTCATGGTG
GGCTGCCAGGACTGTAGTCTCTGGCTGAGGGTCCACTTCGCCGTTGTAGACGACGAAGGGCCCGTCGCATCAACG
AATTCCAACGACGGAAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail