Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9633
Gene name
LocationContig_711:7713..8837
Strand+
Gene length (bp)1124
Transcript length (bp)810
Coding sequence length (bp)810
Protein length (aa) 270

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00244 14-3-3 14-3-3 protein 1.1E-106 9 231

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q99002|1433_TRIHA 14-3-3 protein homolog OS=Trichoderma harzianum PE=2 SV=1 1 237 4.0E-168
sp|O42766|1433_CANAL 14-3-3 protein homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BMH1 PE=3 SV=2 2 267 3.0E-142
sp|P42656|RAD24_SCHPO DNA damage checkpoint protein rad24 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad24 PE=1 SV=2 3 267 6.0E-142
sp|P34730|BMH2_YEAST Protein BMH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BMH2 PE=1 SV=3 4 238 1.0E-138
sp|P29311|BMH1_YEAST Protein BMH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BMH1 PE=1 SV=4 2 240 3.0E-138
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q99002|1433_TRIHA 14-3-3 protein homolog OS=Trichoderma harzianum PE=2 SV=1 1 237 4.0E-168
sp|O42766|1433_CANAL 14-3-3 protein homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BMH1 PE=3 SV=2 2 267 3.0E-142
sp|P42656|RAD24_SCHPO DNA damage checkpoint protein rad24 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad24 PE=1 SV=2 3 267 6.0E-142
sp|P34730|BMH2_YEAST Protein BMH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BMH2 PE=1 SV=3 4 238 1.0E-138
sp|P29311|BMH1_YEAST Protein BMH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BMH1 PE=1 SV=4 2 240 3.0E-138
sp|P62262|1433E_SHEEP 14-3-3 protein epsilon OS=Ovis aries GN=YWHAE PE=1 SV=1 3 232 9.0E-134
sp|P62260|1433E_RAT 14-3-3 protein epsilon OS=Rattus norvegicus GN=Ywhae PE=1 SV=1 3 232 9.0E-134
sp|P62259|1433E_MOUSE 14-3-3 protein epsilon OS=Mus musculus GN=Ywhae PE=1 SV=1 3 232 9.0E-134
sp|P62258|1433E_HUMAN 14-3-3 protein epsilon OS=Homo sapiens GN=YWHAE PE=1 SV=1 3 232 9.0E-134
sp|Q5ZMT0|1433E_CHICK 14-3-3 protein epsilon OS=Gallus gallus GN=YWHAE PE=1 SV=1 3 232 9.0E-134
sp|P62261|1433E_BOVIN 14-3-3 protein epsilon OS=Bos taurus GN=YWHAE PE=2 SV=1 3 232 9.0E-134
sp|P42657|RAD25_SCHPO DNA damage checkpoint protein rad25 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad25 PE=1 SV=1 2 232 2.0E-132
sp|P92177|1433E_DROME 14-3-3 protein epsilon OS=Drosophila melanogaster GN=14-3-3epsilon PE=1 SV=2 3 232 1.0E-130
sp|P54632|1433_DICDI 14-3-3-like protein OS=Dictyostelium discoideum GN=fttB PE=1 SV=2 1 232 2.0E-130
sp|Q9C5W6|14312_ARATH 14-3-3-like protein GF14 iota OS=Arabidopsis thaliana GN=GRF12 PE=2 SV=1 3 263 6.0E-130
sp|Q6ZKC0|14333_ORYSJ 14-3-3-like protein GF14-C OS=Oryza sativa subsp. japonica GN=GF14C PE=1 SV=1 1 239 3.0E-129
sp|P93259|1433_MESCR 14-3-3-like protein OS=Mesembryanthemum crystallinum GN=GBF PE=2 SV=1 3 239 3.0E-129
sp|Q96453|1433D_SOYBN 14-3-3-like protein D OS=Glycine max GN=GF14D PE=2 SV=1 3 249 5.0E-129
sp|Q6EUP4|14335_ORYSJ 14-3-3-like protein GF14-E OS=Oryza sativa subsp. japonica GN=GF14E PE=2 SV=1 1 236 1.0E-128
sp|Q06967|14336_ORYSJ 14-3-3-like protein GF14-F OS=Oryza sativa subsp. japonica GN=GF14F PE=1 SV=2 3 239 4.0E-128
sp|Q7XTE8|14332_ORYSJ 14-3-3-like protein GF14-B OS=Oryza sativa subsp. japonica GN=GF14B PE=1 SV=2 1 236 4.0E-128
sp|P93208|14332_SOLLC 14-3-3 protein 2 OS=Solanum lycopersicum GN=TFT2 PE=3 SV=2 1 239 8.0E-128
sp|P93212|14337_SOLLC 14-3-3 protein 7 OS=Solanum lycopersicum GN=TFT7 PE=2 SV=2 4 245 9.0E-128
sp|Q43470|1433B_HORVU 14-3-3-like protein B OS=Hordeum vulgare PE=2 SV=1 1 250 2.0E-127
sp|P29305|1433A_HORVU 14-3-3-like protein A OS=Hordeum vulgare PE=2 SV=1 3 239 4.0E-127
sp|Q96299|14339_ARATH 14-3-3-like protein GF14 mu OS=Arabidopsis thaliana GN=GRF9 PE=1 SV=2 7 259 5.0E-127
sp|Q41418|14331_SOLTU 14-3-3-like protein OS=Solanum tuberosum PE=2 SV=1 3 232 5.0E-127
sp|P42654|1433B_VICFA 14-3-3-like protein B OS=Vicia faba PE=2 SV=1 3 249 6.0E-127
sp|P46077|14334_ARATH 14-3-3-like protein GF14 phi OS=Arabidopsis thaliana GN=GRF4 PE=1 SV=2 2 259 9.0E-127
sp|P42653|1433A_VICFA 14-3-3-like protein A OS=Vicia faba PE=2 SV=1 3 252 1.0E-126
sp|Q01525|14332_ARATH 14-3-3-like protein GF14 omega OS=Arabidopsis thaliana GN=GRF2 PE=2 SV=2 2 258 1.0E-126
sp|P42644|14333_ARATH 14-3-3-like protein GF14 psi OS=Arabidopsis thaliana GN=GRF3 PE=1 SV=2 3 239 2.0E-126
sp|P46266|1433_PEA 14-3-3-like protein OS=Pisum sativum PE=2 SV=1 3 251 2.0E-126
sp|Q9SP07|1433_LILLO 14-3-3-like protein OS=Lilium longiflorum PE=2 SV=1 3 239 8.0E-126
sp|P93343|1433C_TOBAC 14-3-3-like protein C OS=Nicotiana tabacum PE=1 SV=1 2 239 1.0E-125
sp|O49997|1433E_TOBAC 14-3-3-like protein E OS=Nicotiana tabacum PE=1 SV=1 4 232 1.0E-125
sp|P49106|14331_MAIZE 14-3-3-like protein GF14-6 OS=Zea mays GN=GRF1 PE=3 SV=1 1 236 2.0E-125
sp|O49995|1433B_TOBAC 14-3-3-like protein B OS=Nicotiana tabacum PE=2 SV=1 1 239 2.0E-125
sp|P42652|14334_SOLLC 14-3-3 protein 4 OS=Solanum lycopersicum GN=TFT4 PE=2 SV=1 3 239 5.0E-125
sp|P93784|14335_SOLTU 14-3-3-like protein 16R OS=Solanum tuberosum PE=2 SV=1 3 238 8.0E-125
sp|P93211|14336_SOLLC 14-3-3 protein 6 OS=Solanum lycopersicum GN=TFT6 PE=2 SV=2 3 238 1.0E-124
sp|P29307|1433_OENEH 14-3-3-like protein OS=Oenothera elata subsp. hookeri PE=2 SV=2 3 251 2.0E-124
sp|P42643|14331_ARATH 14-3-3-like protein GF14 chi OS=Arabidopsis thaliana GN=GRF1 PE=1 SV=3 7 232 2.0E-124
sp|O65352|1433_HELAN 14-3-3-like protein OS=Helianthus annuus PE=2 SV=1 3 232 4.0E-124
sp|P52908|1433_CHLRE 14-3-3-like protein OS=Chlamydomonas reinhardtii PE=2 SV=1 4 253 4.0E-124
sp|Q01526|14332_MAIZE 14-3-3-like protein GF14-12 OS=Zea mays GN=GRF2 PE=2 SV=2 1 236 5.0E-124
sp|Q96300|14337_ARATH 14-3-3-like protein GF14 nu OS=Arabidopsis thaliana GN=GRF7 PE=1 SV=1 4 252 9.0E-124
sp|Q96452|1433C_SOYBN 14-3-3-like protein C OS=Glycine max GN=GF14C PE=2 SV=1 3 238 4.0E-123
sp|Q9S9Z8|14311_ARATH 14-3-3-like protein GF14 omicron OS=Arabidopsis thaliana GN=GRF11 PE=2 SV=2 7 239 4.0E-122
sp|P93209|14333_SOLLC 14-3-3 protein 3 OS=Solanum lycopersicum GN=TFT3 PE=2 SV=1 2 251 5.0E-122
sp|Q2R2W2|14334_ORYSJ 14-3-3-like protein GF14-D OS=Oryza sativa subsp. japonica GN=GF14D PE=1 SV=1 3 239 8.0E-122
sp|O49998|1433F_TOBAC 14-3-3-like protein F OS=Nicotiana tabacum PE=2 SV=1 7 238 8.0E-122
sp|P93342|1433A_TOBAC 14-3-3-like protein A OS=Nicotiana tabacum PE=2 SV=1 3 238 1.0E-120
sp|Q43643|14332_SOLTU 14-3-3-like protein RA215 OS=Solanum tuberosum PE=2 SV=1 3 249 4.0E-120
sp|Q41246|1433_TOBAC 14-3-3-like protein OS=Nicotiana tabacum PE=2 SV=1 4 245 8.0E-120
sp|P93214|14339_SOLLC 14-3-3 protein 9 OS=Solanum lycopersicum GN=TFT9 PE=2 SV=2 4 249 1.0E-119
sp|P93210|14335_SOLLC 14-3-3 protein 5 OS=Solanum lycopersicum GN=TFT5 PE=3 SV=1 3 238 5.0E-119
sp|P48347|14310_ARATH 14-3-3-like protein GF14 epsilon OS=Arabidopsis thaliana GN=GRF10 PE=1 SV=1 3 238 1.0E-118
sp|P93213|14338_SOLLC 14-3-3 protein 8 OS=Solanum lycopersicum GN=TFT8 PE=2 SV=2 3 249 2.0E-118
sp|Q96450|1433A_SOYBN 14-3-3-like protein A OS=Glycine max GN=GF14A PE=2 SV=1 3 253 4.0E-118
sp|P42645|14335_ARATH 14-3-3-like protein GF14 upsilon OS=Arabidopsis thaliana GN=GRF5 PE=1 SV=2 2 239 1.0E-117
sp|P93206|14331_SOLLC 14-3-3 protein 1 OS=Solanum lycopersicum GN=TFT1 PE=3 SV=2 1 232 3.0E-117
sp|P48349|14336_ARATH 14-3-3-like protein GF14 lambda OS=Arabidopsis thaliana GN=GRF6 PE=1 SV=1 1 232 5.0E-117
sp|P93207|14310_SOLLC 14-3-3 protein 10 OS=Solanum lycopersicum GN=TFT10 PE=2 SV=2 1 232 8.0E-117
sp|P48348|14338_ARATH 14-3-3-like protein GF14 kappa OS=Arabidopsis thaliana GN=GRF8 PE=1 SV=2 1 232 1.0E-116
sp|O49996|1433D_TOBAC 14-3-3-like protein D OS=Nicotiana tabacum PE=2 SV=1 1 232 1.0E-116
sp|P42650|14333_ENTHI 14-3-3 protein 3 (Fragment) OS=Entamoeba histolytica PE=2 SV=1 4 236 3.0E-116
sp|Q39757|1433_FUCVE 14-3-3-like protein OS=Fucus vesiculosus PE=2 SV=1 2 251 4.0E-115
sp|P42648|14331_ENTHI 14-3-3 protein 1 OS=Entamoeba histolytica PE=3 SV=1 2 232 2.0E-114
sp|Q96451|1433B_SOYBN 14-3-3-like protein B (Fragment) OS=Glycine max GN=GF14B PE=2 SV=1 1 232 4.0E-114
sp|Q84J55|14331_ORYSJ 14-3-3-like protein GF14-A OS=Oryza sativa subsp. japonica GN=GF14A PE=2 SV=1 3 239 6.0E-111
sp|P42649|14332_ENTHI 14-3-3 protein 2 OS=Entamoeba histolytica PE=3 SV=1 2 232 8.0E-110
sp|Q20655|14332_CAEEL 14-3-3-like protein 2 OS=Caenorhabditis elegans GN=ftt-2 PE=1 SV=1 2 246 5.0E-109
sp|Q5PRD0|143BA_DANRE 14-3-3 protein beta/alpha-A OS=Danio rerio GN=ywhaba PE=2 SV=2 1 243 3.0E-108
sp|Q6UFZ9|143B1_ONCMY 14-3-3 protein beta/alpha-1 OS=Oncorhynchus mykiss PE=2 SV=1 1 243 5.0E-108
sp|A4K2U9|1433B_PONAB 14-3-3 protein beta/alpha OS=Pongo abelii GN=YWHAB PE=3 SV=1 1 243 2.0E-107
sp|Q4R572|1433B_MACFA 14-3-3 protein beta/alpha OS=Macaca fascicularis GN=YWHAB PE=2 SV=3 1 243 2.0E-107
sp|P31946|1433B_HUMAN 14-3-3 protein beta/alpha OS=Homo sapiens GN=YWHAB PE=1 SV=3 1 243 2.0E-107
sp|P68250|1433B_BOVIN 14-3-3 protein beta/alpha OS=Bos taurus GN=YWHAB PE=1 SV=2 1 243 2.0E-107
sp|Q5R651|1433Z_PONAB 14-3-3 protein zeta/delta OS=Pongo abelii GN=YWHAZ PE=2 SV=1 1 238 8.0E-107
sp|P63104|1433Z_HUMAN 14-3-3 protein zeta/delta OS=Homo sapiens GN=YWHAZ PE=1 SV=1 1 238 8.0E-107
sp|P63103|1433Z_BOVIN 14-3-3 protein zeta/delta OS=Bos taurus GN=YWHAZ PE=1 SV=1 1 238 8.0E-107
sp|Q91896|1433Z_XENLA 14-3-3 protein zeta OS=Xenopus laevis GN=ywhaz PE=2 SV=2 1 238 1.0E-106
sp|Q6P4Z5|1433Z_XENTR 14-3-3 protein zeta OS=Xenopus tropicalis GN=ywhaz PE=2 SV=1 1 238 1.0E-106
sp|Q8AVQ3|143BB_XENLA 14-3-3 protein beta/alpha-B OS=Xenopus laevis GN=ywhab-b PE=2 SV=1 1 239 2.0E-106
sp|Q5ZKC9|1433Z_CHICK 14-3-3 protein zeta OS=Gallus gallus GN=YWHAZ PE=2 SV=1 1 238 3.0E-106
sp|P63102|1433Z_RAT 14-3-3 protein zeta/delta OS=Rattus norvegicus GN=Ywhaz PE=1 SV=1 1 238 4.0E-106
sp|P63101|1433Z_MOUSE 14-3-3 protein zeta/delta OS=Mus musculus GN=Ywhaz PE=1 SV=1 1 238 4.0E-106
sp|Q5ZLQ6|1433B_CHICK 14-3-3 protein beta/alpha OS=Gallus gallus GN=YWHAB PE=2 SV=1 1 243 4.0E-106
sp|P35213|1433B_RAT 14-3-3 protein beta/alpha OS=Rattus norvegicus GN=Ywhab PE=1 SV=3 1 243 7.0E-106
sp|Q9CQV8|1433B_MOUSE 14-3-3 protein beta/alpha OS=Mus musculus GN=Ywhab PE=1 SV=3 1 243 9.0E-106
sp|Q5XHK2|143BA_XENLA 14-3-3 protein beta/alpha-A OS=Xenopus laevis GN=ywhab-a PE=2 SV=1 1 232 2.0E-105
sp|P29310|1433Z_DROME 14-3-3 protein zeta OS=Drosophila melanogaster GN=14-3-3zeta PE=1 SV=1 4 239 2.0E-105
sp|P29361|1433Z_SHEEP 14-3-3 protein zeta/delta OS=Ovis aries GN=YWHAZ PE=1 SV=1 1 238 3.0E-105
sp|Q5XGC8|1433B_XENTR 14-3-3 protein beta/alpha OS=Xenopus tropicalis GN=ywhab PE=2 SV=1 1 232 4.0E-105
sp|Q2F637|1433Z_BOMMO 14-3-3 protein zeta OS=Bombyx mori GN=14-3-3zeta PE=2 SV=2 4 248 9.0E-105
sp|P29308|1433_SPIOL 14-3-3-like protein (Fragment) OS=Spinacia oleracea PE=2 SV=1 41 232 1.0E-104
sp|Q6UFZ8|143B2_ONCMY 14-3-3 protein beta/alpha-2 OS=Oncorhynchus mykiss PE=2 SV=1 1 232 1.0E-104
sp|P29309|1433_XENLA 14-3-3-like protein (Fragment) OS=Xenopus laevis PE=2 SV=1 10 232 2.0E-104
sp|Q1HR36|1433Z_AEDAE 14-3-3 protein zeta OS=Aedes aegypti GN=14-3-3zeta PE=2 SV=1 4 232 6.0E-104
sp|Q7T356|143BB_DANRE 14-3-3 protein beta/alpha-B OS=Danio rerio GN=ywhabb PE=2 SV=1 1 239 1.0E-103
sp|Q5RFJ2|1433T_PONAB 14-3-3 protein theta OS=Pongo abelii GN=YWHAQ PE=2 SV=2 10 235 4.0E-103
sp|P27348|1433T_HUMAN 14-3-3 protein theta OS=Homo sapiens GN=YWHAQ PE=1 SV=1 10 235 4.0E-103
sp|Q3SZI4|1433T_BOVIN 14-3-3 protein theta OS=Bos taurus GN=YWHAQ PE=2 SV=1 10 235 4.0E-103
sp|Q5QNB8|14337_ORYSJ 14-3-3-like protein GF14-G OS=Oryza sativa subsp. japonica GN=GF14G PE=2 SV=1 4 254 4.0E-103
sp|Q6UFZ2|143G2_ONCMY 14-3-3 protein gamma-2 OS=Oncorhynchus mykiss PE=2 SV=1 4 245 9.0E-103
sp|Q5F3W6|1433G_CHICK 14-3-3 protein gamma OS=Gallus gallus GN=YWHAG PE=1 SV=1 4 244 1.0E-102
sp|Q5ZMD1|1433T_CHICK 14-3-3 protein theta OS=Gallus gallus GN=YWHAQ PE=1 SV=1 10 235 1.0E-102
sp|Q6NRY9|143GB_XENLA 14-3-3 protein gamma-B OS=Xenopus laevis GN=ywhag-b PE=2 SV=1 4 244 2.0E-102
sp|Q52M98|1433T_XENLA 14-3-3 protein theta OS=Xenopus laevis GN=ywhaq PE=2 SV=2 10 235 2.0E-102
sp|P68255|1433T_RAT 14-3-3 protein theta OS=Rattus norvegicus GN=Ywhaq PE=1 SV=1 10 235 2.0E-102
sp|Q6Q6X0|1433T_RABIT 14-3-3 protein theta OS=Oryctolagus cuniculus GN=YWHAQ PE=2 SV=1 10 235 2.0E-102
sp|P68254|1433T_MOUSE 14-3-3 protein theta OS=Mus musculus GN=Ywhaq PE=1 SV=1 10 235 2.0E-102
sp|P68252|1433G_BOVIN 14-3-3 protein gamma OS=Bos taurus GN=YWHAG PE=1 SV=2 4 244 2.0E-102
sp|P61983|1433G_RAT 14-3-3 protein gamma OS=Rattus norvegicus GN=Ywhag PE=1 SV=2 4 244 2.0E-102
sp|Q5RC20|1433G_PONAB 14-3-3 protein gamma OS=Pongo abelii GN=YWHAG PE=2 SV=3 4 244 2.0E-102
sp|P61982|1433G_MOUSE 14-3-3 protein gamma OS=Mus musculus GN=Ywhag PE=1 SV=2 4 244 2.0E-102
sp|P61981|1433G_HUMAN 14-3-3 protein gamma OS=Homo sapiens GN=YWHAG PE=1 SV=2 4 244 2.0E-102
sp|Q6PCG0|143GA_XENLA 14-3-3 protein gamma-A OS=Xenopus laevis GN=ywhag-a PE=2 SV=1 4 244 3.0E-102
sp|Q6PC29|143G1_DANRE 14-3-3 protein gamma-1 OS=Danio rerio GN=ywhag1 PE=2 SV=1 4 244 9.0E-102
sp|P41932|14331_CAEEL 14-3-3-like protein 1 OS=Caenorhabditis elegans GN=par-5 PE=1 SV=2 4 232 1.0E-101
sp|Q25538|1433_NEOCA 14-3-3 protein homolog OS=Neospora caninum PE=2 SV=1 7 257 4.0E-101
sp|O96436|1433_EIMTE 14-3-3 protein OS=Eimeria tenella PE=2 SV=1 3 232 7.0E-101
sp|Q26537|14332_SCHMA 14-3-3 protein homolog 2 (Fragment) OS=Schistosoma mansoni PE=2 SV=1 33 239 1.0E-100
sp|Q6UFZ3|143G1_ONCMY 14-3-3 protein gamma-1 OS=Oncorhynchus mykiss PE=2 SV=1 4 245 2.0E-100
sp|Q04917|1433F_HUMAN 14-3-3 protein eta OS=Homo sapiens GN=YWHAH PE=1 SV=4 10 242 4.0E-100
sp|P68511|1433F_RAT 14-3-3 protein eta OS=Rattus norvegicus GN=Ywhah PE=1 SV=2 10 242 3.0E-99
sp|P68510|1433F_MOUSE 14-3-3 protein eta OS=Mus musculus GN=Ywhah PE=1 SV=2 10 242 3.0E-99
sp|P68509|1433F_BOVIN 14-3-3 protein eta OS=Bos taurus GN=YWHAH PE=1 SV=2 10 242 3.0E-99
sp|P31947|1433S_HUMAN 14-3-3 protein sigma OS=Homo sapiens GN=SFN PE=1 SV=1 10 243 5.0E-97
sp|O70456|1433S_MOUSE 14-3-3 protein sigma OS=Mus musculus GN=Sfn PE=1 SV=2 10 232 1.0E-95
sp|O77642|1433S_SHEEP 14-3-3 protein sigma OS=Ovis aries GN=SFN PE=2 SV=1 10 232 1.0E-93
sp|Q0VC36|1433S_BOVIN 14-3-3 protein sigma OS=Bos taurus GN=SFN PE=2 SV=1 10 232 1.0E-93
sp|Q8MUA4|14332_ECHGR 14-3-3 protein homolog 2 OS=Echinococcus granulosus PE=2 SV=1 3 237 2.0E-90
sp|Q8MM75|14332_ECHMU 14-3-3 protein homolog 2 OS=Echinococcus multilocularis PE=2 SV=1 3 237 7.0E-90
sp|Q26540|14331_SCHMA 14-3-3 protein homolog 1 OS=Schistosoma mansoni PE=2 SV=1 1 238 4.0E-86
sp|Q24902|14331_ECHMU 14-3-3 protein homolog 1 OS=Echinococcus multilocularis PE=2 SV=3 7 237 5.0E-79
sp|Q9U408|14331_ECHGR 14-3-3 protein homolog 1 OS=Echinococcus granulosus PE=2 SV=1 7 237 1.0E-76
sp|Q8SW28|1433_ENCCU 14-3-3 protein homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU03_1010 PE=1 SV=1 3 245 5.0E-73
sp|P68251|1433B_SHEEP 14-3-3 protein beta/alpha (Fragments) OS=Ovis aries GN=YWHAB PE=1 SV=2 1 242 5.0E-70
sp|Q2R1D5|14338_ORYSJ Putative 14-3-3-like protein GF14-H OS=Oryza sativa subsp. japonica GN=GF14H PE=3 SV=1 3 245 5.0E-67
sp|P68253|1433G_SHEEP 14-3-3 protein gamma (Fragments) OS=Ovis aries GN=YWHAG PE=1 SV=1 26 240 5.0E-57
sp|P29306|1433X_MAIZE 14-3-3-like protein (Fragment) OS=Zea mays PE=2 SV=1 183 239 6.0E-24
sp|P85938|14331_PSEMZ 14-3-3-like protein 1 (Fragments) OS=Pseudotsuga menziesii PE=1 SV=1 19 169 3.0E-11
sp|P85939|14332_PSEMZ 14-3-3-like protein 2 (Fragments) OS=Pseudotsuga menziesii PE=1 SV=1 181 224 1.0E-10
sp|C6TH93|CASP4_SOYBN Casparian strip membrane protein 4 OS=Glycine max PE=2 SV=1 4 41 3.0E-09
sp|P85939|14332_PSEMZ 14-3-3-like protein 2 (Fragments) OS=Pseudotsuga menziesii PE=1 SV=1 12 72 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9633
MGHEDSVYLAKLAEQAERYEEMVENMKIVASEDRDLTVEERNLLSVAYKNVIGARRASWRIVTSIEQKEESKGNS
SQVTLIKEYRQKIEAELAKICDDILDVLDKHLIPSATTGESKVFYHKMKGDYHRYLAEFAIGDRRKDSADKSLEA
YKAATDVAHTELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLIMQLLRD
NLTLWTSSEAETGGAAGQTDAPAKEEPAAAAEPAAATEEPKAAE*
Coding >Hirsu2|9633
ATGGGTCACGAAGATTCCGTCTACCTGGCCAAGCTCGCCGAGCAGGCCGAGCGTTACGAGGAAATGGTGGAGAAC
ATGAAGATTGTCGCCTCCGAGGACCGCGACCTCACCGTCGAGGAGCGGAACCTCCTTTCCGTCGCCTACAAGAAC
GTCATCGGCGCTCGCCGTGCCTCGTGGAGAATAGTCACTTCCATCGAGCAGAAGGAGGAATCCAAGGGCAACTCG
TCCCAGGTCACCCTCATCAAGGAGTATAGGCAGAAGATTGAGGCCGAGCTCGCCAAGATCTGCGACGATATCCTC
GACGTCCTCGACAAGCACCTGATTCCCTCGGCCACGACGGGCGAGTCCAAGGTCTTCTACCACAAGATGAAGGGC
GACTACCACCGTTACCTCGCCGAGTTCGCCATTGGCGACCGCCGCAAGGACTCCGCCGACAAGTCTCTCGAGGCC
TACAAGGCCGCCACCGACGTCGCCCACACTGAGCTGCCTCCCACCCACCCCATCCGCCTGGGTCTCGCCCTGAAC
TTCTCCGTCTTCTACTACGAGATCCTCAACGCCCCCGATCAGGCCTGCCACCTTGCCAAGCAGGCCTTTGACGAT
GCCATTGCTGAACTCGATACACTGAGTGAGGAGAGCTACAAGGACTCGACCCTCATCATGCAGCTCCTGCGTGAC
AACCTGACGCTCTGGACCTCGTCCGAGGCCGAGACTGGCGGTGCTGCTGGCCAGACCGACGCGCCCGCCAAGGAG
GAGCCGGCCGCCGCGGCCGAGCCTGCCGCCGCGACCGAGGAGCCCAAGGCTGCCGAGTAA
Transcript >Hirsu2|9633
ATGGGTCACGAAGATTCCGTCTACCTGGCCAAGCTCGCCGAGCAGGCCGAGCGTTACGAGGAAATGGTGGAGAAC
ATGAAGATTGTCGCCTCCGAGGACCGCGACCTCACCGTCGAGGAGCGGAACCTCCTTTCCGTCGCCTACAAGAAC
GTCATCGGCGCTCGCCGTGCCTCGTGGAGAATAGTCACTTCCATCGAGCAGAAGGAGGAATCCAAGGGCAACTCG
TCCCAGGTCACCCTCATCAAGGAGTATAGGCAGAAGATTGAGGCCGAGCTCGCCAAGATCTGCGACGATATCCTC
GACGTCCTCGACAAGCACCTGATTCCCTCGGCCACGACGGGCGAGTCCAAGGTCTTCTACCACAAGATGAAGGGC
GACTACCACCGTTACCTCGCCGAGTTCGCCATTGGCGACCGCCGCAAGGACTCCGCCGACAAGTCTCTCGAGGCC
TACAAGGCCGCCACCGACGTCGCCCACACTGAGCTGCCTCCCACCCACCCCATCCGCCTGGGTCTCGCCCTGAAC
TTCTCCGTCTTCTACTACGAGATCCTCAACGCCCCCGATCAGGCCTGCCACCTTGCCAAGCAGGCCTTTGACGAT
GCCATTGCTGAACTCGATACACTGAGTGAGGAGAGCTACAAGGACTCGACCCTCATCATGCAGCTCCTGCGTGAC
AACCTGACGCTCTGGACCTCGTCCGAGGCCGAGACTGGCGGTGCTGCTGGCCAGACCGACGCGCCCGCCAAGGAG
GAGCCGGCCGCCGCGGCCGAGCCTGCCGCCGCGACCGAGGAGCCCAAGGCTGCCGAGTAA
Gene >Hirsu2|9633
ATGGGTCACGAAGATTCCGTCTACCTGGCCAAGCTCGCCGAGCAGGCCGAGCGTTACGAGGGTAAGTCTCCGTCG
TCCACCGGCTGCCTCCTTGCCGCTGACGCCTCGCCTGCTCTGCCCAGAAATGGTGGAGAACATGAAGATTGTCGC
CTCCGAGGACCGCGACCTCACCGTCGAGGAGCGGAACCTCCTTTCCGTCGCCTACAAGAACGTCATCGGCGCTCG
CCGTGCCTCGTGGAGAATAGTCACTTCCATCGAGCAGAAGGAGGAATCCAAGGGCAACTCGTCCCAGGTCACCCT
CATCAAGGAGTATAGGCAGAAGATTGAGGCCGAGCTCGCCAAGATCTGCGACGATATCCTCGACGTCCTCGACAA
GCACCTGATTCCCTCGGCCACGACGGGCGAGTCCAAGGTCTTCTACCACAAGATGTGCGCCCCGCCCCGAGCCCA
GTCGCGCCCCGCCTCGCGCCCTGCCCCGCTGACTTGCACTCCAGGAAGGGCGACTACCACCGTTACCTCGCCGAG
TTCGCCATTGGCGACCGCCGCAAGGACTCCGCCGACAAGTCTCTCGAGGCCTACAAGGCCGCCACCGACGTCGCC
CACACTGAGCTGCCTCCCACCCACCCCATCCGCCTGGGTCTCGCCCTGAACTTCTCCGTCTTCTACTACGAGATC
CTCAACGCCCCCGATCAGGCCTGCCACCTTGCCAAGCAGGCCTTTGACGATGCCATTGCTGGTATGTCGCTCCCT
CGCCATCCTGTCTCCCCCCTCCCTCTTGTTTTCTCTCCTTTTTTTTTCTCTCTTGTTTTCTGTCACCTTTTTTCT
TGATTTGCAATCGGAATATGCTGACCCGTGACGACAGAACTCGATACACTGAGTGAGGAGAGCTACAAGGACTCG
ACCCTCATCATGCAGCTCCTGCGTGACAACCTGGTATGCGCTGCCTCCCCTATTCCACGCCTCGACCCCCAGGAG
CAACGACTGACTCCCGGTAGACGCTCTGGACCTCGTCCGAGGCCGAGACTGGCGGTGCTGCTGGCCAGACCGACG
CGCCCGCCAAGGAGGAGCCGGCCGCCGCGGCCGAGCCTGCCGCCGCGACCGAGGAGCCCAAGGCTGCCGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail