Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9631
Gene name
LocationContig_711:3243..3938
Strand+
Gene length (bp)695
Transcript length (bp)630
Coding sequence length (bp)630
Protein length (aa) 210

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05064 Nsp1_C Nsp1-like C-terminal region 3.2E-33 1 89

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|G0SBQ3|NSP1_CHATD Nucleoporin NSP1 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NSP1 PE=1 SV=1 1 207 3.0E-87
sp|P37198|NUP62_HUMAN Nuclear pore glycoprotein p62 OS=Homo sapiens GN=NUP62 PE=1 SV=3 1 176 4.0E-28
sp|P17955|NUP62_RAT Nuclear pore glycoprotein p62 OS=Rattus norvegicus GN=Nup62 PE=1 SV=1 1 181 2.0E-27
sp|Q63850|NUP62_MOUSE Nuclear pore glycoprotein p62 OS=Mus musculus GN=Nup62 PE=1 SV=2 1 176 2.0E-27
sp|Q10168|NSP1_SCHPO Nucleoporin nsp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nsp1 PE=1 SV=1 1 166 4.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|G0SBQ3|NSP1_CHATD Nucleoporin NSP1 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NSP1 PE=1 SV=1 1 207 3.0E-87
sp|P37198|NUP62_HUMAN Nuclear pore glycoprotein p62 OS=Homo sapiens GN=NUP62 PE=1 SV=3 1 176 4.0E-28
sp|P17955|NUP62_RAT Nuclear pore glycoprotein p62 OS=Rattus norvegicus GN=Nup62 PE=1 SV=1 1 181 2.0E-27
sp|Q63850|NUP62_MOUSE Nuclear pore glycoprotein p62 OS=Mus musculus GN=Nup62 PE=1 SV=2 1 176 2.0E-27
sp|Q10168|NSP1_SCHPO Nucleoporin nsp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nsp1 PE=1 SV=1 1 166 4.0E-25
sp|P14907|NSP1_YEAST Nucleoporin NSP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSP1 PE=1 SV=1 1 181 2.0E-22
sp|Q8L7F7|NUP62_ARATH Nuclear pore complex protein NUP62 OS=Arabidopsis thaliana GN=NUP62 PE=1 SV=1 1 184 1.0E-16
sp|Q9H1M0|N62CL_HUMAN Nucleoporin-62 C-terminal-like protein OS=Homo sapiens GN=NUP62CL PE=1 SV=3 1 84 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9631
MEDIVTRWASDLSKYQKEFKEQATIVSTWDRNLVDNGEKIQKLYLDTFEAERASHEIERQLVAVESQQDELEAWL
DRYESEVQDMFVKQIGPGEQLAGPDQERERTYKLAEKLTQQLDEKSRDLSKMVKEINEISGTLSKGAKAEDPLSQ
IVRVLNGHLTQLQWIDANAAALQAKVAAAQKSSGALNSHYAGADTDAAESFYRSYMGRR*
Coding >Hirsu2|9631
ATGGAGGATATCGTCACGCGTTGGGCCTCGGATCTATCCAAGTACCAGAAAGAATTCAAAGAGCAGGCCACCATC
GTGTCGACTTGGGATAGAAACCTGGTCGACAACGGGGAGAAGATCCAGAAGCTGTACCTGGACACCTTCGAGGCC
GAGCGAGCCAGCCACGAGATCGAGCGACAGCTGGTGGCGGTGGAGAGCCAGCAGGACGAGCTCGAAGCGTGGCTG
GACCGGTACGAATCCGAGGTGCAGGACATGTTCGTCAAGCAGATCGGCCCCGGGGAGCAGCTGGCCGGGCCGGAC
CAGGAGCGAGAGCGGACGTACAAGCTCGCAGAGAAGCTGACGCAGCAGCTGGACGAGAAGTCGCGAGACCTGTCC
AAGATGGTCAAGGAGATCAACGAGATCTCGGGCACCCTGAGCAAGGGGGCCAAGGCCGAGGATCCGCTGAGCCAG
ATCGTGCGCGTCCTCAACGGCCACCTCACGCAGCTGCAGTGGATCGATGCCAACGCGGCGGCGCTGCAGGCCAAG
GTGGCTGCGGCGCAGAAGTCGAGCGGCGCGCTGAACAGCCACTACGCCGGGGCGGACACTGACGCGGCAGAGAGC
TTCTACCGCTCGTACATGGGGCGACGGTGA
Transcript >Hirsu2|9631
ATGGAGGATATCGTCACGCGTTGGGCCTCGGATCTATCCAAGTACCAGAAAGAATTCAAAGAGCAGGCCACCATC
GTGTCGACTTGGGATAGAAACCTGGTCGACAACGGGGAGAAGATCCAGAAGCTGTACCTGGACACCTTCGAGGCC
GAGCGAGCCAGCCACGAGATCGAGCGACAGCTGGTGGCGGTGGAGAGCCAGCAGGACGAGCTCGAAGCGTGGCTG
GACCGGTACGAATCCGAGGTGCAGGACATGTTCGTCAAGCAGATCGGCCCCGGGGAGCAGCTGGCCGGGCCGGAC
CAGGAGCGAGAGCGGACGTACAAGCTCGCAGAGAAGCTGACGCAGCAGCTGGACGAGAAGTCGCGAGACCTGTCC
AAGATGGTCAAGGAGATCAACGAGATCTCGGGCACCCTGAGCAAGGGGGCCAAGGCCGAGGATCCGCTGAGCCAG
ATCGTGCGCGTCCTCAACGGCCACCTCACGCAGCTGCAGTGGATCGATGCCAACGCGGCGGCGCTGCAGGCCAAG
GTGGCTGCGGCGCAGAAGTCGAGCGGCGCGCTGAACAGCCACTACGCCGGGGCGGACACTGACGCGGCAGAGAGC
TTCTACCGCTCGTACATGGGGCGACGGTGA
Gene >Hirsu2|9631
ATGGAGGATATCGTCACGCGTTGGGCCTCGGATCTATCCAAGTACCAGAAAGAATTCAAAGAGCAGGCCACCATC
GTGTCGACTTGGGATAGAAACCTGGTCGACAACGGGGAGAAGATCCAGAAGCTGTACCTGGACACCTTCGAGGCC
GAGCGAGCCAGCCACGAGATCGAGCGACAGCTGGTGGCGGTGGAGAGCCAGCAGGACGAGCTCGAAGCGTGGCTG
GACCGGTACGAATCCGAGGTGCAGGACATGTTCGTCAAGCAGATCGGCCCCGGGGAGCAGCTGGCCGGGCCGGAC
CAGGAGCGAGAGCGGACGTACAAGCTCGCAGAGAAGCTGACGCAGCAGCTGGACGAGAAGTCGCGAGACCTGTCC
AAGATGGTCAAGGAGATCAACGAGATCTCGGGCACCCTGAGCAAGGGGGCCAAGGCCGAGGATCCGGTAAGCATG
AGAGATCCCCCCAGTCCCCCAGCCCGACCCGTTGGGACGCTAACTCGGCGACGCAGCTGAGCCAGATCGTGCGCG
TCCTCAACGGCCACCTCACGCAGCTGCAGTGGATCGATGCCAACGCGGCGGCGCTGCAGGCCAAGGTGGCTGCGG
CGCAGAAGTCGAGCGGCGCGCTGAACAGCCACTACGCCGGGGCGGACACTGACGCGGCAGAGAGCTTCTACCGCT
CGTACATGGGGCGACGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail