Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9627
Gene name
LocationContig_710:5816..7373
Strand+
Gene length (bp)1557
Transcript length (bp)1557
Coding sequence length (bp)1557
Protein length (aa) 519

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03006 HlyIII Haemolysin-III related 6.3E-57 276 498

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09910|YAJB_SCHPO Uncharacterized protein C30D11.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC30D11.11 PE=4 SV=1 70 504 5.0E-75
sp|Q07959|IZH3_YEAST ADIPOR-like receptor IZH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IZH3 PE=1 SV=1 239 470 3.0E-40
sp|Q94177|ADRL_CAEEL Progestin and adipoQ receptor-like protein 1 OS=Caenorhabditis elegans GN=paqr-1 PE=3 SV=2 130 518 3.0E-32
sp|Q9VCY8|ADRL_DROME Adiponectin receptor protein OS=Drosophila melanogaster GN=AdipoR PE=1 SV=2 245 503 2.0E-31
sp|Q86V24|ADR2_HUMAN Adiponectin receptor protein 2 OS=Homo sapiens GN=ADIPOR2 PE=1 SV=1 241 504 3.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09910|YAJB_SCHPO Uncharacterized protein C30D11.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC30D11.11 PE=4 SV=1 70 504 5.0E-75
sp|Q07959|IZH3_YEAST ADIPOR-like receptor IZH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IZH3 PE=1 SV=1 239 470 3.0E-40
sp|Q94177|ADRL_CAEEL Progestin and adipoQ receptor-like protein 1 OS=Caenorhabditis elegans GN=paqr-1 PE=3 SV=2 130 518 3.0E-32
sp|Q9VCY8|ADRL_DROME Adiponectin receptor protein OS=Drosophila melanogaster GN=AdipoR PE=1 SV=2 245 503 2.0E-31
sp|Q86V24|ADR2_HUMAN Adiponectin receptor protein 2 OS=Homo sapiens GN=ADIPOR2 PE=1 SV=1 241 504 3.0E-30
sp|Q75F81|IZH3_ASHGO ADIPOR-like receptor IZH3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IZH3 PE=3 SV=1 233 504 5.0E-30
sp|Q8BQS5|ADR2_MOUSE Adiponectin receptor protein 2 OS=Mus musculus GN=Adipor2 PE=1 SV=2 241 504 6.0E-30
sp|Q91VH1|ADR1_MOUSE Adiponectin receptor protein 1 OS=Mus musculus GN=Adipor1 PE=1 SV=1 179 504 2.0E-29
sp|Q96A54|ADR1_HUMAN Adiponectin receptor protein 1 OS=Homo sapiens GN=ADIPOR1 PE=1 SV=1 241 504 3.0E-29
sp|Q9ZUH8|HHP3_ARATH Heptahelical transmembrane protein 3 OS=Arabidopsis thaliana GN=HHP3 PE=2 SV=2 240 516 4.0E-25
sp|Q6TCG8|PAQR3_MOUSE Progestin and adipoQ receptor family member 3 OS=Mus musculus GN=Paqr3 PE=2 SV=1 234 517 1.0E-24
sp|Q6TCH7|PAQR3_HUMAN Progestin and adipoQ receptor family member 3 OS=Homo sapiens GN=PAQR3 PE=1 SV=2 234 517 4.0E-24
sp|Q753H5|IZH1_ASHGO ADIPOR-like receptor IZH1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IZH1 PE=3 SV=1 209 501 5.0E-23
sp|Q03419|IZH1_YEAST ADIPOR-like receptor IZH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IZH1 PE=1 SV=1 213 501 1.0E-22
sp|Q09749|ADRL_SCHPO ADIPOR-like receptor SPBC12C2.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC12C2.09c PE=3 SV=1 238 498 7.0E-22
sp|Q93ZH9|HHP1_ARATH Heptahelical transmembrane protein 1 OS=Arabidopsis thaliana GN=HHP1 PE=1 SV=1 238 516 3.0E-21
sp|Q84N34|HHP2_ARATH Heptahelical transmembrane protein 2 OS=Arabidopsis thaliana GN=HHP2 PE=2 SV=1 239 516 9.0E-21
sp|Q9SVF3|HPP5_ARATH Heptahelical transmembrane protein 5 OS=Arabidopsis thaliana GN=HHP5 PE=2 SV=1 355 500 6.0E-19
sp|A8WZU4|ADRL_CAEBR Progestin and adipoQ receptor-like protein 1 OS=Caenorhabditis briggsae GN=paqr-1 PE=3 SV=2 208 517 1.0E-18
sp|Q9SZG0|HHP4_ARATH Heptahelical transmembrane protein 4 OS=Arabidopsis thaliana GN=HHP4 PE=2 SV=1 355 500 2.0E-18
sp|Q10PI5|ADPO3_ORYSJ Heptahelical transmembrane protein ADIPOR3 OS=Oryza sativa subsp. japonica GN=ADIPOR3 PE=2 SV=1 355 498 9.0E-18
sp|Q12442|IZH2_YEAST ADIPOR-like receptor IZH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IZH2 PE=1 SV=2 240 515 3.0E-17
sp|Q6ETK9|ADPO2_ORYSJ Heptahelical transmembrane protein ADIPOR2 OS=Oryza sativa subsp. japonica GN=ADIPOR2 PE=2 SV=1 351 506 1.0E-16
sp|B7F9G7|ADPO1_ORYSJ Heptahelical transmembrane protein ADIPOR1 OS=Oryza sativa subsp. japonica GN=ADIPOR1 PE=2 SV=1 241 518 2.0E-16
sp|Q9JJE4|PAQR4_MOUSE Progestin and adipoQ receptor family member 4 OS=Mus musculus GN=Paqr4 PE=2 SV=1 241 517 3.0E-11
sp|Q8N4S7|PAQR4_HUMAN Progestin and adipoQ receptor family member 4 OS=Homo sapiens GN=PAQR4 PE=2 SV=3 241 517 5.0E-10
sp|Q9NXK6|MPRG_HUMAN Membrane progestin receptor gamma OS=Homo sapiens GN=PAQR5 PE=1 SV=2 241 490 2.0E-07
sp|Q9DCU0|MPRG_MOUSE Membrane progestin receptor gamma OS=Mus musculus GN=Paqr5 PE=2 SV=1 241 490 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

Domain # Start End Length
1 285 304 19
2 317 339 22
3 349 371 22
4 384 403 19
5 413 435 22
6 442 464 22
7 479 501 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9627
MLLRSRNIYVMGDLTTGLSSACGCQARDDDDLAAVSGSDVQRSSDAVPRRRHSFFLPRRRSFVEAIMDGEEGLLL
KVDLFLSELERRLEFIESYGDLSRDYSFSRPFSTLQAVRSRCSQASEEVIGAGRRRLQVMVETLEARYQETLAAT
ESLHEKARLGVDLLEGMLSEFESRAYKLREQSLANAATAAEAFMDEGRRVASEGIERARGVVDGGIERAKRAALS
LEEHIQHAVGLARERRLLLYDDLPMPWRNNPHIKKGYRFTESKLECVRSMFDISNESFNIWSHALGLVVVLSVAL
YFYPTSANFGLSTKSDVLVAAVFFVMAGLTMCCSIVWHTMNAVADANAISTFACVDYTGISLLIAASILTTEYTA
FYCDPVSRWTYMTLTAILGVGGVVLPWQPSFNDADRAWARVAFYSGLALTGAMPVMQLYLTHGPDFVASFYSPIS
KSLAAYIAGAVVYASKIPERWYPGVFDYIGGSHNLWHVAVFGGILFHYAAMQEFFSNAFHRAESGCPA*
Coding >Hirsu2|9627
ATGCTGCTCCGGAGCCGAAACATCTACGTCATGGGCGACCTGACGACGGGCCTCTCATCGGCATGCGGCTGCCAG
GCGCGGGACGACGACGACCTGGCTGCAGTCTCCGGGTCCGACGTGCAGCGCAGCTCTGATGCCGTCCCGCGACGT
CGACACTCGTTCTTCCTGCCGCGGAGGAGGTCCTTTGTCGAGGCCATCATGGACGGCGAGGAGGGCTTGCTGCTC
AAGGTCGACCTCTTCCTCTCCGAGCTGGAGAGGCGGCTAGAGTTCATCGAAAGCTACGGCGACCTGAGCCGGGAC
TACAGCTTCTCGCGCCCGTTCTCGACCCTCCAGGCCGTCCGATCGCGATGCTCCCAGGCCTCCGAAGAGGTCATC
GGAGCCGGCCGGCGGAGGCTGCAGGTCATGGTCGAGACTCTGGAGGCGCGATACCAGGAGACGCTGGCCGCGACC
GAGTCGCTCCACGAAAAGGCCCGCTTGGGCGTCGATCTCCTCGAGGGCATGCTGTCCGAGTTCGAGAGCCGGGCC
TACAAGCTGCGGGAACAGAGCCTTGCGAATGCGGCCACGGCGGCCGAGGCCTTCATGGACGAGGGCCGGCGAGTC
GCCAGCGAAGGCATCGAACGAGCGAGGGGCGTCGTCGACGGAGGCATCGAGCGCGCCAAGCGAGCGGCCCTGTCG
CTCGAGGAGCACATCCAACACGCCGTCGGCCTGGCAAGGGAGCGGCGACTCCTGCTCTACGACGACTTGCCCATG
CCGTGGCGCAACAACCCGCACATCAAAAAGGGCTACCGCTTCACCGAGTCCAAGCTCGAATGTGTGCGCTCCATG
TTCGACATCTCCAACGAGTCCTTCAACATCTGGTCCCACGCCCTGGGCCTCGTCGTCGTCCTCTCCGTCGCCCTC
TACTTCTACCCGACCAGCGCCAACTTCGGCCTCAGCACCAAGAGCGACGTCTTGGTCGCCGCCGTCTTCTTCGTC
ATGGCCGGCCTGACCATGTGCTGCTCCATCGTGTGGCACACGATGAACGCCGTTGCCGACGCCAACGCAATCTCC
ACCTTCGCCTGCGTCGACTACACCGGCATCTCCCTCTTGATCGCGGCCTCGATCCTGACGACCGAGTACACGGCC
TTCTACTGCGACCCCGTCAGCCGCTGGACCTACATGACGCTGACGGCCATCCTCGGCGTCGGCGGCGTTGTCCTG
CCGTGGCAGCCGAGCTTCAACGACGCCGACAGGGCCTGGGCTAGGGTTGCCTTCTACAGCGGCCTTGCCCTGACG
GGGGCCATGCCCGTCATGCAGCTGTACCTGACCCACGGGCCCGACTTCGTCGCCAGCTTCTACTCGCCCATCTCC
AAGTCCCTGGCCGCCTACATCGCGGGCGCCGTCGTCTACGCGAGCAAGATCCCCGAGAGGTGGTACCCGGGCGTC
TTCGACTACATCGGCGGAAGCCACAACCTGTGGCACGTCGCCGTCTTCGGCGGCATCCTGTTCCACTACGCCGCC
ATGCAGGAGTTCTTCTCCAACGCCTTCCACCGCGCCGAGAGCGGCTGCCCTGCCTGA
Transcript >Hirsu2|9627
ATGCTGCTCCGGAGCCGAAACATCTACGTCATGGGCGACCTGACGACGGGCCTCTCATCGGCATGCGGCTGCCAG
GCGCGGGACGACGACGACCTGGCTGCAGTCTCCGGGTCCGACGTGCAGCGCAGCTCTGATGCCGTCCCGCGACGT
CGACACTCGTTCTTCCTGCCGCGGAGGAGGTCCTTTGTCGAGGCCATCATGGACGGCGAGGAGGGCTTGCTGCTC
AAGGTCGACCTCTTCCTCTCCGAGCTGGAGAGGCGGCTAGAGTTCATCGAAAGCTACGGCGACCTGAGCCGGGAC
TACAGCTTCTCGCGCCCGTTCTCGACCCTCCAGGCCGTCCGATCGCGATGCTCCCAGGCCTCCGAAGAGGTCATC
GGAGCCGGCCGGCGGAGGCTGCAGGTCATGGTCGAGACTCTGGAGGCGCGATACCAGGAGACGCTGGCCGCGACC
GAGTCGCTCCACGAAAAGGCCCGCTTGGGCGTCGATCTCCTCGAGGGCATGCTGTCCGAGTTCGAGAGCCGGGCC
TACAAGCTGCGGGAACAGAGCCTTGCGAATGCGGCCACGGCGGCCGAGGCCTTCATGGACGAGGGCCGGCGAGTC
GCCAGCGAAGGCATCGAACGAGCGAGGGGCGTCGTCGACGGAGGCATCGAGCGCGCCAAGCGAGCGGCCCTGTCG
CTCGAGGAGCACATCCAACACGCCGTCGGCCTGGCAAGGGAGCGGCGACTCCTGCTCTACGACGACTTGCCCATG
CCGTGGCGCAACAACCCGCACATCAAAAAGGGCTACCGCTTCACCGAGTCCAAGCTCGAATGTGTGCGCTCCATG
TTCGACATCTCCAACGAGTCCTTCAACATCTGGTCCCACGCCCTGGGCCTCGTCGTCGTCCTCTCCGTCGCCCTC
TACTTCTACCCGACCAGCGCCAACTTCGGCCTCAGCACCAAGAGCGACGTCTTGGTCGCCGCCGTCTTCTTCGTC
ATGGCCGGCCTGACCATGTGCTGCTCCATCGTGTGGCACACGATGAACGCCGTTGCCGACGCCAACGCAATCTCC
ACCTTCGCCTGCGTCGACTACACCGGCATCTCCCTCTTGATCGCGGCCTCGATCCTGACGACCGAGTACACGGCC
TTCTACTGCGACCCCGTCAGCCGCTGGACCTACATGACGCTGACGGCCATCCTCGGCGTCGGCGGCGTTGTCCTG
CCGTGGCAGCCGAGCTTCAACGACGCCGACAGGGCCTGGGCTAGGGTTGCCTTCTACAGCGGCCTTGCCCTGACG
GGGGCCATGCCCGTCATGCAGCTGTACCTGACCCACGGGCCCGACTTCGTCGCCAGCTTCTACTCGCCCATCTCC
AAGTCCCTGGCCGCCTACATCGCGGGCGCCGTCGTCTACGCGAGCAAGATCCCCGAGAGGTGGTACCCGGGCGTC
TTCGACTACATCGGCGGAAGCCACAACCTGTGGCACGTCGCCGTCTTCGGCGGCATCCTGTTCCACTACGCCGCC
ATGCAGGAGTTCTTCTCCAACGCCTTCCACCGCGCCGAGAGCGGCTGCCCTGCCTGA
Gene >Hirsu2|9627
ATGCTGCTCCGGAGCCGAAACATCTACGTCATGGGCGACCTGACGACGGGCCTCTCATCGGCATGCGGCTGCCAG
GCGCGGGACGACGACGACCTGGCTGCAGTCTCCGGGTCCGACGTGCAGCGCAGCTCTGATGCCGTCCCGCGACGT
CGACACTCGTTCTTCCTGCCGCGGAGGAGGTCCTTTGTCGAGGCCATCATGGACGGCGAGGAGGGCTTGCTGCTC
AAGGTCGACCTCTTCCTCTCCGAGCTGGAGAGGCGGCTAGAGTTCATCGAAAGCTACGGCGACCTGAGCCGGGAC
TACAGCTTCTCGCGCCCGTTCTCGACCCTCCAGGCCGTCCGATCGCGATGCTCCCAGGCCTCCGAAGAGGTCATC
GGAGCCGGCCGGCGGAGGCTGCAGGTCATGGTCGAGACTCTGGAGGCGCGATACCAGGAGACGCTGGCCGCGACC
GAGTCGCTCCACGAAAAGGCCCGCTTGGGCGTCGATCTCCTCGAGGGCATGCTGTCCGAGTTCGAGAGCCGGGCC
TACAAGCTGCGGGAACAGAGCCTTGCGAATGCGGCCACGGCGGCCGAGGCCTTCATGGACGAGGGCCGGCGAGTC
GCCAGCGAAGGCATCGAACGAGCGAGGGGCGTCGTCGACGGAGGCATCGAGCGCGCCAAGCGAGCGGCCCTGTCG
CTCGAGGAGCACATCCAACACGCCGTCGGCCTGGCAAGGGAGCGGCGACTCCTGCTCTACGACGACTTGCCCATG
CCGTGGCGCAACAACCCGCACATCAAAAAGGGCTACCGCTTCACCGAGTCCAAGCTCGAATGTGTGCGCTCCATG
TTCGACATCTCCAACGAGTCCTTCAACATCTGGTCCCACGCCCTGGGCCTCGTCGTCGTCCTCTCCGTCGCCCTC
TACTTCTACCCGACCAGCGCCAACTTCGGCCTCAGCACCAAGAGCGACGTCTTGGTCGCCGCCGTCTTCTTCGTC
ATGGCCGGCCTGACCATGTGCTGCTCCATCGTGTGGCACACGATGAACGCCGTTGCCGACGCCAACGCAATCTCC
ACCTTCGCCTGCGTCGACTACACCGGCATCTCCCTCTTGATCGCGGCCTCGATCCTGACGACCGAGTACACGGCC
TTCTACTGCGACCCCGTCAGCCGCTGGACCTACATGACGCTGACGGCCATCCTCGGCGTCGGCGGCGTTGTCCTG
CCGTGGCAGCCGAGCTTCAACGACGCCGACAGGGCCTGGGCTAGGGTTGCCTTCTACAGCGGCCTTGCCCTGACG
GGGGCCATGCCCGTCATGCAGCTGTACCTGACCCACGGGCCCGACTTCGTCGCCAGCTTCTACTCGCCCATCTCC
AAGTCCCTGGCCGCCTACATCGCGGGCGCCGTCGTCTACGCGAGCAAGATCCCCGAGAGGTGGTACCCGGGCGTC
TTCGACTACATCGGCGGAAGCCACAACCTGTGGCACGTCGCCGTCTTCGGCGGCATCCTGTTCCACTACGCCGCC
ATGCAGGAGTTCTTCTCCAACGCCTTCCACCGCGCCGAGAGCGGCTGCCCTGCCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail