Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9624
Gene name
LocationContig_71:38291..39002
Strand-
Gene length (bp)711
Transcript length (bp)711
Coding sequence length (bp)711
Protein length (aa) 237

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01375 Enterotoxin_a Heat-labile enterotoxin alpha chain 1.4E-09 10 121

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0090729 toxin activity Yes
GO:0005615 extracellular space Yes
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3421 0.9068 0.5104 0.0224 0.037 0.0032 0.0631 0.0227 0.0215 0.0032

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6063
Change Orthofinder run
Species Protein ID
Ophiocordyceps subramaniannii Hirsu2|2342
Ophiocordyceps subramaniannii Hirsu2|7056
Ophiocordyceps subramaniannii Hirsu2|9624 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9624
MHFANSDDEDYDSEDSSAEGETEASAYVSTAQTSQYAIKVNEAVNHTIYVIDATPNFFVNDGVEDEVLAVGGILL
SQIIGWAPWSTEDEIFTPEELNNRLQRNEYYDSTRWQGLEATPGLPQDWDHEHPIESATRLLDRVGKHVGWNGRF
PLPFDRERPCRPDEPSTSGTCRPSTSRGPDQDEPPSKKPNVDPAQPSTSKGTSQERAAACVSQQFGGDAKSAFGT
SGHGTVWESPS*
Coding >Hirsu2|9624
ATGCACTTTGCGAACTCGGACGACGAGGACTATGACTCTGAAGACTCCAGCGCTGAGGGTGAGACGGAGGCAAGC
GCCTACGTGTCGACCGCGCAGACCAGCCAGTACGCAATCAAAGTCAACGAGGCGGTGAACCACACGATCTATGTC
ATCGATGCTACGCCCAATTTCTTCGTGAATGACGGCGTGGAAGATGAGGTGCTTGCGGTCGGAGGCATCCTATTG
TCACAAATCATAGGATGGGCTCCTTGGTCGACTGAGGACGAGATCTTTACTCCCGAGGAGCTCAACAACCGCCTC
CAGCGTAACGAATACTACGATTCCACGCGCTGGCAAGGTCTAGAGGCGACGCCCGGCCTTCCACAAGATTGGGAC
CACGAGCACCCGATCGAATCCGCCACCAGGCTCCTGGACCGGGTCGGAAAGCACGTCGGCTGGAATGGACGCTTC
CCTCTGCCGTTCGACCGCGAGCGGCCGTGCCGGCCGGACGAGCCGAGCACCAGCGGGACGTGCCGGCCCAGCACT
TCGCGCGGCCCCGACCAGGACGAGCCGCCGAGCAAGAAGCCGAACGTAGACCCGGCTCAGCCGAGTACTTCCAAG
GGCACTTCGCAGGAGCGTGCGGCCGCTTGCGTGAGCCAGCAGTTCGGCGGCGACGCGAAGTCGGCGTTCGGTACG
TCGGGCCACGGGACCGTATGGGAATCTCCGAGTTAA
Transcript >Hirsu2|9624
ATGCACTTTGCGAACTCGGACGACGAGGACTATGACTCTGAAGACTCCAGCGCTGAGGGTGAGACGGAGGCAAGC
GCCTACGTGTCGACCGCGCAGACCAGCCAGTACGCAATCAAAGTCAACGAGGCGGTGAACCACACGATCTATGTC
ATCGATGCTACGCCCAATTTCTTCGTGAATGACGGCGTGGAAGATGAGGTGCTTGCGGTCGGAGGCATCCTATTG
TCACAAATCATAGGATGGGCTCCTTGGTCGACTGAGGACGAGATCTTTACTCCCGAGGAGCTCAACAACCGCCTC
CAGCGTAACGAATACTACGATTCCACGCGCTGGCAAGGTCTAGAGGCGACGCCCGGCCTTCCACAAGATTGGGAC
CACGAGCACCCGATCGAATCCGCCACCAGGCTCCTGGACCGGGTCGGAAAGCACGTCGGCTGGAATGGACGCTTC
CCTCTGCCGTTCGACCGCGAGCGGCCGTGCCGGCCGGACGAGCCGAGCACCAGCGGGACGTGCCGGCCCAGCACT
TCGCGCGGCCCCGACCAGGACGAGCCGCCGAGCAAGAAGCCGAACGTAGACCCGGCTCAGCCGAGTACTTCCAAG
GGCACTTCGCAGGAGCGTGCGGCCGCTTGCGTGAGCCAGCAGTTCGGCGGCGACGCGAAGTCGGCGTTCGGTACG
TCGGGCCACGGGACCGTATGGGAATCTCCGAGTTAA
Gene >Hirsu2|9624
ATGCACTTTGCGAACTCGGACGACGAGGACTATGACTCTGAAGACTCCAGCGCTGAGGGTGAGACGGAGGCAAGC
GCCTACGTGTCGACCGCGCAGACCAGCCAGTACGCAATCAAAGTCAACGAGGCGGTGAACCACACGATCTATGTC
ATCGATGCTACGCCCAATTTCTTCGTGAATGACGGCGTGGAAGATGAGGTGCTTGCGGTCGGAGGCATCCTATTG
TCACAAATCATAGGATGGGCTCCTTGGTCGACTGAGGACGAGATCTTTACTCCCGAGGAGCTCAACAACCGCCTC
CAGCGTAACGAATACTACGATTCCACGCGCTGGCAAGGTCTAGAGGCGACGCCCGGCCTTCCACAAGATTGGGAC
CACGAGCACCCGATCGAATCCGCCACCAGGCTCCTGGACCGGGTCGGAAAGCACGTCGGCTGGAATGGACGCTTC
CCTCTGCCGTTCGACCGCGAGCGGCCGTGCCGGCCGGACGAGCCGAGCACCAGCGGGACGTGCCGGCCCAGCACT
TCGCGCGGCCCCGACCAGGACGAGCCGCCGAGCAAGAAGCCGAACGTAGACCCGGCTCAGCCGAGTACTTCCAAG
GGCACTTCGCAGGAGCGTGCGGCCGCTTGCGTGAGCCAGCAGTTCGGCGGCGACGCGAAGTCGGCGTTCGGTACG
TCGGGCCACGGGACCGTATGGGAATCTCCGAGTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail