Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9622
Gene name
LocationContig_71:33503..35257
Strand+
Gene length (bp)1754
Transcript length (bp)1605
Coding sequence length (bp)1605
Protein length (aa) 535

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07731 Cu-oxidase_2 Multicopper oxidase 1.6E-33 378 499
PF00394 Cu-oxidase Multicopper oxidase 2.2E-32 169 312
PF07732 Cu-oxidase_3 Multicopper oxidase 1.9E-21 88 158

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q96WM9|LAC2_BOTFU Laccase-2 OS=Botryotinia fuckeliana GN=lcc2 PE=2 SV=1 37 534 4.0E-127
sp|Q12570|LAC1_BOTFU Laccase-1 OS=Botryotinia fuckeliana GN=lcc1 PE=2 SV=3 38 534 2.0E-123
sp|Q96UM2|LAC3_BOTFU Laccase-3 (Fragment) OS=Botryotinia fuckeliana GN=lcc3 PE=3 SV=1 89 495 2.0E-109
sp|P06811|LAC1_NEUCR Laccase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=lacc PE=1 SV=3 38 534 2.0E-106
sp|Q70KY3|LAC1_MELAO Laccase-1 OS=Melanocarpus albomyces GN=LAC1 PE=1 SV=1 3 534 8.0E-98
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q96WM9|LAC2_BOTFU Laccase-2 OS=Botryotinia fuckeliana GN=lcc2 PE=2 SV=1 37 534 4.0E-127
sp|Q12570|LAC1_BOTFU Laccase-1 OS=Botryotinia fuckeliana GN=lcc1 PE=2 SV=3 38 534 2.0E-123
sp|Q96UM2|LAC3_BOTFU Laccase-3 (Fragment) OS=Botryotinia fuckeliana GN=lcc3 PE=3 SV=1 89 495 2.0E-109
sp|P06811|LAC1_NEUCR Laccase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=lacc PE=1 SV=3 38 534 2.0E-106
sp|Q70KY3|LAC1_MELAO Laccase-1 OS=Melanocarpus albomyces GN=LAC1 PE=1 SV=1 3 534 8.0E-98
sp|Q03966|LAC1_CRYPA Laccase OS=Cryphonectria parasitica GN=LAC-1 PE=3 SV=1 30 534 2.0E-96
sp|P78722|LAC2_PODAS Laccase-2 OS=Podospora anserina GN=LAC2 PE=2 SV=1 39 534 1.0E-92
sp|D4APX3|LAC1_ARTBC Laccase ARB_05828 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05828 PE=1 SV=1 44 534 2.0E-91
sp|Q99055|LAC4_TRAVI Laccase-4 OS=Trametes villosa GN=LCC4 PE=3 SV=1 80 502 3.0E-54
sp|Q12719|LAC4_TRAVE Laccase-4 OS=Trametes versicolor GN=LCC4 PE=3 SV=1 80 502 6.0E-54
sp|Q02081|LAC4_THACU Laccase-4 OS=Thanatephorus cucumeris GN=LCC4 PE=1 SV=1 60 483 3.0E-52
sp|Q12717|LAC5_TRAVE Laccase-5 OS=Trametes versicolor GN=LCC5 PE=2 SV=1 80 501 3.0E-50
sp|Q99056|LAC5_TRAVI Laccase-5 OS=Trametes villosa GN=LCC5 PE=3 SV=2 80 501 8.0E-50
sp|Q12542|LAC2_AGABI Laccase-2 OS=Agaricus bisporus GN=lcc2 PE=1 SV=1 92 501 3.0E-48
sp|Q01679|LAC1_PHLRA Laccase OS=Phlebia radiata GN=LAC PE=1 SV=2 91 505 4.0E-48
sp|Q12729|LAC1_PLEOS Laccase-1 OS=Pleurotus ostreatus GN=POX1 PE=2 SV=1 91 504 2.0E-47
sp|Q12541|LAC1_AGABI Laccase-1 OS=Agaricus bisporus GN=lcc1 PE=1 SV=1 65 501 3.0E-46
sp|Q12739|LAC2_PLEOS Laccase-2 OS=Pleurotus ostreatus GN=POX2 PE=1 SV=1 91 533 4.0E-46
sp|O59896|LAC1_PYCCI Laccase OS=Pycnoporus cinnabarinus GN=LCC3-1 PE=1 SV=1 70 505 3.0E-45
sp|Q99046|LAC2_TRAVI Laccase-2 OS=Trametes villosa GN=LCC2 PE=3 SV=1 80 504 4.0E-45
sp|Q12718|LAC2_TRAVE Laccase-2 OS=Trametes versicolor GN=LCC2 PE=1 SV=1 80 504 1.0E-44
sp|D0VWU3|LAC1_TRAMX Laccase OS=Trametes maxima PE=1 SV=1 72 505 3.0E-44
sp|Q99044|LAC1_TRAVI Laccase-1 OS=Trametes villosa GN=LCC1 PE=3 SV=1 70 502 6.0E-42
sp|Q0JHP8|LAC8_ORYSJ Laccase-8 OS=Oryza sativa subsp. japonica GN=LAC8 PE=3 SV=2 1 495 6.0E-42
sp|P14133|ASO_CUCSA L-ascorbate oxidase OS=Cucumis sativus PE=1 SV=1 90 524 1.0E-41
sp|Q09920|FIO1_SCHPO Iron transport multicopper oxidase fio1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fio1 PE=3 SV=1 91 515 2.0E-41
sp|Q02497|LAC1_TRAHI Laccase OS=Trametes hirsuta PE=1 SV=1 80 502 2.0E-39
sp|Q9SR40|LAC7_ARATH Laccase-7 OS=Arabidopsis thaliana GN=LAC7 PE=2 SV=1 92 498 2.0E-39
sp|P37064|ASO_CUCPM L-ascorbate oxidase OS=Cucurbita pepo var. melopepo PE=1 SV=1 90 516 3.0E-39
sp|Q2QUN2|LAC24_ORYSJ Laccase-24 OS=Oryza sativa subsp. japonica GN=LAC24 PE=2 SV=1 92 495 4.0E-38
sp|P24792|ASO_CUCMA L-ascorbate oxidase OS=Cucurbita maxima GN=AAO PE=1 SV=2 90 516 2.0E-37
sp|Q5N7B4|LAC7_ORYSJ Laccase-7 OS=Oryza sativa subsp. japonica GN=LAC7 PE=2 SV=1 92 495 7.0E-37
sp|Q9FLB5|LAC12_ARATH Laccase-12 OS=Arabidopsis thaliana GN=LAC12 PE=2 SV=1 92 496 1.0E-36
sp|O80434|LAC4_ARATH Laccase-4 OS=Arabidopsis thaliana GN=IRX12 PE=2 SV=2 92 496 4.0E-36
sp|Q0IP28|LAC25_ORYSJ Laccase-25 OS=Oryza sativa subsp. japonica GN=LAC25 PE=3 SV=1 92 493 2.0E-35
sp|Q9LFD2|LAC8_ARATH Laccase-8 OS=Arabidopsis thaliana GN=LAC8 PE=2 SV=1 92 503 7.0E-35
sp|Q6ID18|LAC10_ARATH Laccase-10 OS=Arabidopsis thaliana GN=LAC10 PE=2 SV=1 92 496 9.0E-35
sp|Q99049|LAC3_TRAVI Laccase-3 OS=Trametes villosa GN=LCC3 PE=3 SV=1 70 501 4.0E-34
sp|Q5N9W4|LAC5_ORYSJ Putative laccase-5 OS=Oryza sativa subsp. japonica GN=LAC5 PE=3 SV=1 92 504 2.0E-33
sp|Q69L99|LAC14_ORYSJ Laccase-14 OS=Oryza sativa subsp. japonica GN=LAC14 PE=3 SV=1 92 495 3.0E-32
sp|Q2R0L0|LAC20_ORYSJ Laccase-20 OS=Oryza sativa subsp. japonica GN=LAC20 PE=2 SV=1 87 496 1.0E-31
sp|P43561|FET5_YEAST Iron transport multicopper oxidase FET5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FET5 PE=1 SV=1 90 497 3.0E-31
sp|A2Y9C2|LAC20_ORYSI Laccase-20 OS=Oryza sativa subsp. indica GN=LAC20 PE=3 SV=1 87 496 7.0E-31
sp|Q96WT3|FET3_CANGA Iron transport multicopper oxidase FET3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FET3 PE=3 SV=1 52 514 1.0E-30
sp|Q8RYM9|LAC2_ORYSJ Laccase-2 OS=Oryza sativa subsp. japonica GN=LAC2 PE=2 SV=1 87 496 2.0E-30
sp|Q9SIY8|LAC5_ARATH Laccase-5 OS=Arabidopsis thaliana GN=LAC5 PE=2 SV=1 92 496 4.0E-29
sp|Q6CII3|FET3_KLULA Iron transport multicopper oxidase FET3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=FET3 PE=3 SV=1 91 513 7.0E-29
sp|Q02075|LAC2_THACU Laccase-2 OS=Thanatephorus cucumeris GN=LCC2 PE=2 SV=1 82 337 2.0E-28
sp|Q02079|LAC3_THACU Laccase-3 OS=Thanatephorus cucumeris GN=LCC3 PE=2 SV=1 65 313 1.0E-27
sp|P38993|FET3_YEAST Iron transport multicopper oxidase FET3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FET3 PE=1 SV=2 90 494 2.0E-27
sp|P56193|LAC1_THACU Laccase-1 OS=Thanatephorus cucumeris GN=LCC1 PE=1 SV=1 65 280 2.0E-27
sp|Q56YT0|LAC3_ARATH Laccase-3 OS=Arabidopsis thaliana GN=LAC3 PE=2 SV=2 92 496 8.0E-27
sp|P78591|FET3_CANAX Iron transport multicopper oxidase FET3 OS=Candida albicans GN=FET3 PE=3 SV=1 91 502 1.0E-26
sp|Q7XE50|LAC16_ORYSJ Putative laccase-16 OS=Oryza sativa subsp. japonica GN=LAC16 PE=5 SV=1 94 503 1.0E-25
sp|Q5ZCW1|LAC1_ORYSJ Putative laccase-1 OS=Oryza sativa subsp. japonica GN=LAC1 PE=3 SV=1 92 503 3.0E-25
sp|Q9FY79|LAC14_ARATH Laccase-14 OS=Arabidopsis thaliana GN=LAC14 PE=2 SV=1 92 498 3.0E-25
sp|I6WZK7|MMCO_MYCTU Multicopper oxidase MmcO OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmcO PE=1 SV=1 87 495 4.0E-24
sp|Q5N9X2|LAC4_ORYSJ Laccase-4 OS=Oryza sativa subsp. japonica GN=LAC4 PE=2 SV=1 87 330 4.0E-24
sp|Q9FJD5|LAC17_ARATH Laccase-17 OS=Arabidopsis thaliana GN=LAC17 PE=2 SV=1 87 293 3.0E-23
sp|Q0DHL2|LAC12_ORYSJ Laccase-12/13 OS=Oryza sativa subsp. japonica GN=LAC12 PE=2 SV=1 92 331 1.0E-22
sp|Q5N7A3|LAC6_ORYSJ Laccase-6 OS=Oryza sativa subsp. japonica GN=LAC6 PE=2 SV=1 92 317 3.0E-22
sp|Q0DHL5|LAC11_ORYSJ Putative laccase-11 OS=Oryza sativa subsp. japonica GN=LAC11 PE=5 SV=2 92 331 3.0E-22
sp|Q9LFD1|LAC9_ARATH Laccase-9 OS=Arabidopsis thaliana GN=LAC9 PE=2 SV=1 92 367 5.0E-21
sp|Q9LYQ2|LAC13_ARATH Laccase-13 OS=Arabidopsis thaliana GN=LAC13 PE=2 SV=1 92 280 2.0E-20
sp|Q2RBK2|LAC17_ORYSJ Putative laccase-17 OS=Oryza sativa subsp. japonica GN=LAC17 PE=3 SV=1 92 280 8.0E-20
sp|Q9LMS3|LAC1_ARATH Laccase-1 OS=Arabidopsis thaliana GN=LAC1 PE=2 SV=1 87 280 8.0E-20
sp|Q339K6|LAC15_ORYSJ Laccase-15 OS=Oryza sativa subsp. japonica GN=LAC15 PE=2 SV=1 421 496 9.0E-20
sp|Q04399|GMC1_YEAST Putative multicopper oxidase GMC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GMC1 PE=1 SV=1 91 495 1.0E-19
sp|Q2QYS3|LAC23_ORYSJ Laccase-23 OS=Oryza sativa subsp. japonica GN=LAC23 PE=3 SV=1 92 280 2.0E-19
sp|Q941X2|LAC3_ORYSJ Laccase-3 OS=Oryza sativa subsp. japonica GN=LAC3 PE=2 SV=1 92 317 4.0E-19
sp|Q1PDH6|LAC16_ARATH Laccase-16 OS=Arabidopsis thaliana GN=LAC16 PE=2 SV=2 92 279 1.0E-18
sp|Q941X2|LAC3_ORYSJ Laccase-3 OS=Oryza sativa subsp. japonica GN=LAC3 PE=2 SV=1 405 496 2.0E-18
sp|O81081|LAC2_ARATH Laccase-2 OS=Arabidopsis thaliana GN=LAC2 PE=2 SV=1 87 327 2.0E-18
sp|Q10ND7|LAC10_ORYSJ Laccase-10 OS=Oryza sativa subsp. japonica GN=LAC10 PE=2 SV=1 87 278 1.0E-17
sp|Q8VZA1|LAC11_ARATH Laccase-11 OS=Arabidopsis thaliana GN=LAC11 PE=2 SV=1 92 280 3.0E-17
sp|A2Y9C5|LAC19_ORYSI Putative laccase-19 OS=Oryza sativa subsp. indica GN=LAC19 PE=3 SV=1 90 279 4.0E-17
sp|Q2R0L2|LAC19_ORYSJ Laccase-19 OS=Oryza sativa subsp. japonica GN=LAC19 PE=2 SV=1 90 279 4.0E-17
sp|Q9ZPY2|LAC6_ARATH Laccase-6 OS=Arabidopsis thaliana GN=LAC6 PE=2 SV=1 91 331 7.0E-17
sp|Q2QYS3|LAC23_ORYSJ Laccase-23 OS=Oryza sativa subsp. japonica GN=LAC23 PE=3 SV=1 420 496 8.0E-17
sp|Q40588|ASO_TOBAC L-ascorbate oxidase OS=Nicotiana tabacum GN=AAO PE=2 SV=1 90 289 8.0E-17
sp|Q40588|ASO_TOBAC L-ascorbate oxidase OS=Nicotiana tabacum GN=AAO PE=2 SV=1 420 510 1.0E-16
sp|Q6Z8L2|LAC9_ORYSJ Putative laccase-9 OS=Oryza sativa subsp. japonica GN=LAC9 PE=3 SV=1 92 503 2.0E-16
sp|Q0IQU1|LAC22_ORYSJ Laccase-22 OS=Oryza sativa subsp. japonica GN=LAC22 PE=2 SV=2 87 281 2.0E-16
sp|Q2RBK2|LAC17_ORYSJ Putative laccase-17 OS=Oryza sativa subsp. japonica GN=LAC17 PE=3 SV=1 420 496 3.0E-16
sp|Q339K6|LAC15_ORYSJ Laccase-15 OS=Oryza sativa subsp. japonica GN=LAC15 PE=2 SV=1 92 279 5.0E-16
sp|A2XCN6|LAC18_ORYSI Putative laccase-18 OS=Oryza sativa subsp. indica GN=LAC18 PE=3 SV=1 89 279 1.0E-15
sp|Q53LU4|LAC18_ORYSJ Laccase-18 OS=Oryza sativa subsp. japonica GN=LAC18 PE=2 SV=1 89 276 1.0E-15
sp|Q02075|LAC2_THACU Laccase-2 OS=Thanatephorus cucumeris GN=LCC2 PE=2 SV=1 331 502 3.0E-15
sp|Q0DHL5|LAC11_ORYSJ Putative laccase-11 OS=Oryza sativa subsp. japonica GN=LAC11 PE=5 SV=2 420 503 3.0E-15
sp|Q9LYQ2|LAC13_ARATH Laccase-13 OS=Arabidopsis thaliana GN=LAC13 PE=2 SV=1 420 501 3.0E-15
sp|Q84J37|LAC15_ARATH Laccase-15 OS=Arabidopsis thaliana GN=TT10 PE=1 SV=1 92 333 9.0E-15
sp|Q8VZA1|LAC11_ARATH Laccase-11 OS=Arabidopsis thaliana GN=LAC11 PE=2 SV=1 420 505 1.0E-14
sp|O81081|LAC2_ARATH Laccase-2 OS=Arabidopsis thaliana GN=LAC2 PE=2 SV=1 420 503 2.0E-14
sp|Q10ND7|LAC10_ORYSJ Laccase-10 OS=Oryza sativa subsp. japonica GN=LAC10 PE=2 SV=1 420 503 3.0E-14
sp|Q9ZPY2|LAC6_ARATH Laccase-6 OS=Arabidopsis thaliana GN=LAC6 PE=2 SV=1 420 498 1.0E-13
sp|Q5N7A3|LAC6_ORYSJ Laccase-6 OS=Oryza sativa subsp. japonica GN=LAC6 PE=2 SV=1 405 495 2.0E-13
sp|A2Y9C5|LAC19_ORYSI Putative laccase-19 OS=Oryza sativa subsp. indica GN=LAC19 PE=3 SV=1 420 496 3.0E-13
sp|Q2R0L2|LAC19_ORYSJ Laccase-19 OS=Oryza sativa subsp. japonica GN=LAC19 PE=2 SV=1 420 496 3.0E-13
sp|A2XCN6|LAC18_ORYSI Putative laccase-18 OS=Oryza sativa subsp. indica GN=LAC18 PE=3 SV=1 420 496 4.0E-13
sp|Q9LMS3|LAC1_ARATH Laccase-1 OS=Arabidopsis thaliana GN=LAC1 PE=2 SV=1 420 504 5.0E-13
sp|Q2QZ80|LAC21_ORYSJ Laccase-21 OS=Oryza sativa subsp. japonica GN=LAC21 PE=2 SV=1 390 503 5.0E-13
sp|Q0IQU1|LAC22_ORYSJ Laccase-22 OS=Oryza sativa subsp. japonica GN=LAC22 PE=2 SV=2 417 496 6.0E-13
sp|Q5N9X2|LAC4_ORYSJ Laccase-4 OS=Oryza sativa subsp. japonica GN=LAC4 PE=2 SV=1 420 496 1.0E-12
sp|Q0DHL2|LAC12_ORYSJ Laccase-12/13 OS=Oryza sativa subsp. japonica GN=LAC12 PE=2 SV=1 420 496 1.0E-12
sp|Q53LU4|LAC18_ORYSJ Laccase-18 OS=Oryza sativa subsp. japonica GN=LAC18 PE=2 SV=1 420 496 1.0E-12
sp|Q9LFD1|LAC9_ARATH Laccase-9 OS=Arabidopsis thaliana GN=LAC9 PE=2 SV=1 417 496 4.0E-12
sp|Q9FJD5|LAC17_ARATH Laccase-17 OS=Arabidopsis thaliana GN=LAC17 PE=2 SV=1 420 511 5.0E-12
sp|Q2QZ80|LAC21_ORYSJ Laccase-21 OS=Oryza sativa subsp. japonica GN=LAC21 PE=2 SV=1 92 342 5.0E-12
sp|Q1PDH6|LAC16_ARATH Laccase-16 OS=Arabidopsis thaliana GN=LAC16 PE=2 SV=2 420 496 2.0E-11
sp|Q84J37|LAC15_ARATH Laccase-15 OS=Arabidopsis thaliana GN=TT10 PE=1 SV=1 420 501 2.0E-11
sp|P56193|LAC1_THACU Laccase-1 OS=Thanatephorus cucumeris GN=LCC1 PE=1 SV=1 365 513 7.0E-11
sp|Q47452|PCOA_ECOLX Copper resistance protein A OS=Escherichia coli GN=pcoA PE=3 SV=1 91 276 7.0E-11
sp|Q00624|ASOL_BRANA L-ascorbate oxidase homolog OS=Brassica napus GN=Bp10 PE=2 SV=1 93 280 1.0E-10
sp|Q9SU40|SKU5_ARATH Monocopper oxidase-like protein SKU5 OS=Arabidopsis thaliana GN=SKU5 PE=1 SV=1 84 280 2.0E-10
sp|Q02079|LAC3_THACU Laccase-3 OS=Thanatephorus cucumeris GN=LCC3 PE=2 SV=1 365 502 5.0E-10
sp|P59571|COPA_PSESM Copper resistance protein A homolog OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=copA PE=3 SV=1 91 283 6.0E-10
sp|Q9FHN6|SKS2_ARATH Monocopper oxidase-like protein SKS2 OS=Arabidopsis thaliana GN=SKS2 PE=1 SV=1 97 280 8.0E-10
sp|P12374|COPA_PSEUB Copper resistance protein A OS=Pseudomonas syringae pv. tomato GN=copA PE=1 SV=1 84 276 8.0E-10
sp|Q8VXX5|SKS1_ARATH Monocopper oxidase-like protein SKS1 OS=Arabidopsis thaliana GN=SKS1 PE=1 SV=1 97 477 3.0E-09
sp|P17489|LAC1_EMENI Laccase-1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=yA PE=2 SV=3 91 219 3.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0005507 copper ion binding Yes
GO:0003824 catalytic activity No
GO:0046872 metal ion binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0046914 transition metal ion binding No
GO:0003674 molecular_function No
GO:0043169 cation binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1593 0.143 0.8329 0.2415 0.092 0.0378 0.2365 0.1659 0.0557 0.034

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.999777

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
AA1_3 4.5E-97 89 323

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup416
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7396
Ophiocordyceps australis map64 (Brazil) OphauB2|7897
Ophiocordyceps camponoti-floridani Ophcf2|03021
Ophiocordyceps camponoti-floridani Ophcf2|07232
Ophiocordyceps camponoti-rufipedis Ophun1|2520
Ophiocordyceps camponoti-rufipedis Ophun1|3408
Ophiocordyceps camponoti-rufipedis Ophun1|3926
Ophiocordyceps kimflemingae Ophio5|2677
Ophiocordyceps subramaniannii Hirsu2|3355
Ophiocordyceps subramaniannii Hirsu2|9622 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9622
MIMKLLLLRLPLVLQVVAASPLSEATSFGPRGPPCRGNTPTTRGQWCGHSINTDYTREAPNTGVTREYWLELTDV
MVAPDGVSRPAIGNGTSIHFHGIRQLFTNQNDGVTSVTQCPTPVGHSVTYRWRALQYGSTWYHSHFALQAWEGVY
GGLVINGPATANYDEDLGPLILTDWSHTTVDQFSAQDKGQLLPPIMDSGLINGTNTFRTGGRRLTIRVSAGKSYR
IRLVNAAVDTHFKFSVDHHTLKVIAADLVPIKPYSTKVINISMGQRYDIVLTANQGHFARNFWMRTVPQACSFNR
NAHQIRAIVHYDDALSTPSTIRYPSVPLCKDETRNLIPYIKKGFGNANRQSSEIVAIKKRGPLFHWTLNSTAMRL
EWGNPTLKKIMDRNPAFRRSNAVIELPEPNIMFAMVIQTYLPVPHPIHLHGHDFYILAQGVGVYSHNRVQLNHIN
PPRRDTAILPALGYLVIAFETDNPGAWLMHCHIGFHLNDGFGLQFIERAREIPAIIDRALLDSGCAAWRSFQALN
SINQDDSGV*
Coding >Hirsu2|9622
ATGATCATGAAATTACTTCTCTTGAGGCTGCCCCTCGTTCTTCAAGTCGTGGCCGCTTCTCCTCTTTCAGAGGCG
ACGTCCTTCGGGCCTCGAGGCCCGCCGTGTCGGGGTAATACACCAACAACCCGCGGGCAGTGGTGCGGTCACTCG
ATCAACACGGATTACACTCGCGAGGCACCCAACACAGGAGTGACCCGTGAATACTGGCTAGAGCTCACAGACGTC
ATGGTTGCCCCCGACGGGGTTTCTCGTCCGGCCATTGGGAACGGCACCAGCATTCACTTTCACGGAATCCGACAG
CTCTTCACGAACCAGAATGACGGCGTCACGTCAGTTACGCAGTGTCCCACTCCAGTTGGACACTCCGTGACTTAT
CGATGGCGAGCCTTGCAGTACGGCTCGACGTGGTATCACTCCCATTTCGCTCTGCAAGCCTGGGAGGGCGTTTAT
GGTGGCCTTGTTATTAATGGGCCTGCGACGGCGAACTACGACGAGGACCTTGGCCCTCTTATCTTGACCGATTGG
TCTCACACTACTGTCGACCAGTTTTCAGCCCAGGATAAAGGCCAGCTTCTGCCCCCTATTATGGATAGCGGCCTG
ATCAACGGGACGAATACCTTTCGGACCGGGGGGCGACGATTGACGATTCGGGTATCGGCAGGGAAATCATACCGA
ATCCGTCTCGTCAATGCTGCCGTTGACACACACTTCAAGTTTTCGGTAGACCACCATACGTTGAAAGTAATCGCG
GCCGATCTAGTTCCCATCAAGCCCTACTCGACCAAGGTAATTAATATCAGTATGGGCCAGAGGTATGATATCGTC
CTGACTGCCAACCAAGGACACTTCGCACGGAATTTCTGGATGAGGACTGTCCCGCAGGCTTGTTCTTTCAATCGT
AACGCTCACCAGATCCGGGCGATAGTTCACTATGATGATGCGCTTTCGACGCCCTCGACTATCAGGTATCCGAGC
GTGCCTCTCTGCAAAGACGAGACGAGAAACCTGATCCCATATATTAAGAAGGGCTTTGGCAATGCCAATAGACAG
AGCTCAGAAATCGTGGCCATCAAGAAGCGCGGTCCTCTCTTCCACTGGACTCTAAATAGTACAGCGATGAGGCTC
GAATGGGGCAATCCGACTTTAAAGAAAATCATGGACCGCAACCCTGCTTTCCGTCGGAGCAATGCCGTCATCGAG
CTGCCAGAGCCCAACATTATGTTTGCTATGGTTATACAGACTTACCTCCCCGTCCCTCACCCGATTCACTTACAT
GGCCACGACTTTTACATCTTGGCTCAAGGTGTTGGTGTCTATTCACACAACCGCGTGCAGCTGAATCACATCAAC
CCTCCCCGCCGAGATACGGCAATTCTGCCGGCTTTGGGATACCTTGTCATTGCATTCGAGACGGACAATCCCGGA
GCGTGGTTGATGCACTGCCACATCGGTTTTCACCTCAATGACGGATTCGGCCTTCAGTTCATCGAGCGCGCTAGG
GAGATACCGGCGATCATTGATAGGGCTCTTCTTGATAGCGGGTGCGCTGCGTGGAGGTCTTTCCAGGCCCTTAAT
TCCATTAATCAGGATGACTCTGGTGTTTAG
Transcript >Hirsu2|9622
ATGATCATGAAATTACTTCTCTTGAGGCTGCCCCTCGTTCTTCAAGTCGTGGCCGCTTCTCCTCTTTCAGAGGCG
ACGTCCTTCGGGCCTCGAGGCCCGCCGTGTCGGGGTAATACACCAACAACCCGCGGGCAGTGGTGCGGTCACTCG
ATCAACACGGATTACACTCGCGAGGCACCCAACACAGGAGTGACCCGTGAATACTGGCTAGAGCTCACAGACGTC
ATGGTTGCCCCCGACGGGGTTTCTCGTCCGGCCATTGGGAACGGCACCAGCATTCACTTTCACGGAATCCGACAG
CTCTTCACGAACCAGAATGACGGCGTCACGTCAGTTACGCAGTGTCCCACTCCAGTTGGACACTCCGTGACTTAT
CGATGGCGAGCCTTGCAGTACGGCTCGACGTGGTATCACTCCCATTTCGCTCTGCAAGCCTGGGAGGGCGTTTAT
GGTGGCCTTGTTATTAATGGGCCTGCGACGGCGAACTACGACGAGGACCTTGGCCCTCTTATCTTGACCGATTGG
TCTCACACTACTGTCGACCAGTTTTCAGCCCAGGATAAAGGCCAGCTTCTGCCCCCTATTATGGATAGCGGCCTG
ATCAACGGGACGAATACCTTTCGGACCGGGGGGCGACGATTGACGATTCGGGTATCGGCAGGGAAATCATACCGA
ATCCGTCTCGTCAATGCTGCCGTTGACACACACTTCAAGTTTTCGGTAGACCACCATACGTTGAAAGTAATCGCG
GCCGATCTAGTTCCCATCAAGCCCTACTCGACCAAGGTAATTAATATCAGTATGGGCCAGAGGTATGATATCGTC
CTGACTGCCAACCAAGGACACTTCGCACGGAATTTCTGGATGAGGACTGTCCCGCAGGCTTGTTCTTTCAATCGT
AACGCTCACCAGATCCGGGCGATAGTTCACTATGATGATGCGCTTTCGACGCCCTCGACTATCAGGTATCCGAGC
GTGCCTCTCTGCAAAGACGAGACGAGAAACCTGATCCCATATATTAAGAAGGGCTTTGGCAATGCCAATAGACAG
AGCTCAGAAATCGTGGCCATCAAGAAGCGCGGTCCTCTCTTCCACTGGACTCTAAATAGTACAGCGATGAGGCTC
GAATGGGGCAATCCGACTTTAAAGAAAATCATGGACCGCAACCCTGCTTTCCGTCGGAGCAATGCCGTCATCGAG
CTGCCAGAGCCCAACATTATGTTTGCTATGGTTATACAGACTTACCTCCCCGTCCCTCACCCGATTCACTTACAT
GGCCACGACTTTTACATCTTGGCTCAAGGTGTTGGTGTCTATTCACACAACCGCGTGCAGCTGAATCACATCAAC
CCTCCCCGCCGAGATACGGCAATTCTGCCGGCTTTGGGATACCTTGTCATTGCATTCGAGACGGACAATCCCGGA
GCGTGGTTGATGCACTGCCACATCGGTTTTCACCTCAATGACGGATTCGGCCTTCAGTTCATCGAGCGCGCTAGG
GAGATACCGGCGATCATTGATAGGGCTCTTCTTGATAGCGGGTGCGCTGCGTGGAGGTCTTTCCAGGCCCTTAAT
TCCATTAATCAGGATGACTCTGGTGTTTAG
Gene >Hirsu2|9622
ATGATCATGAAATTACTTCTCTTGAGGCTGCCCCTCGTTCTTCAAGTCGTGGCCGCTTCTCCTCTTTCAGAGGCG
ACGTCCTTCGGGCCTCGAGGCCCGCCGTGTCGGGGTAATACACCAACAACCCGCGGGCAGTGGTGCGGTCACTCG
ATCAACACGGATTACACTCGCGAGGCACCCAACACAGGAGTGACCCGTGAATACTGGCTAGAGCTCACAGACGTC
ATGGTTGCCCCCGACGGGGTTTCTCGTCCGGCCATTGGTGAGCTGGCCACCGTCAGTCCCGGGTCGATGACGCGG
CTGACCTTGAGGCCATACAAGCTGTGAACGGGACCATCCCGGGCCCCACGATTTTTGCCGATTGGGGAGACAATG
TTGTCGTTCATGTGAAAAATTCCTTGTTTGAATCAGGGAACGGCACCAGCATTCACTTTCACGGAATCCGACAGC
TCTTCACGAACCAGAATGACGGCGTCACGTCAGTTACGCAGTGTCCCACTCCAGTTGGACACTCCGTGACTTATC
GATGGCGAGCCTTGCAGTACGGCTCGACGTGGTATCACTCCCATTTCGCTCTGCAAGCCTGGGAGGGCGTTTATG
GTGGCCTTGTTATTAATGGGCCTGCGACGGCGAACTACGACGAGGACCTTGGCCCTCTTATCTTGACCGATTGGT
CTCACACTACTGTCGACCAGTTTTCAGCCCAGGATAAAGGCCAGCTTCTGCCCCCTATTATGGATAGCGGCCTGA
TCAACGGGACGAATACCTTTCGGACCGGGGGGCGACGATTGACGATTCGGGTATCGGCAGGGAAATCATACCGAA
TCCGTCTCGTCAATGCTGCCGTTGACACACACTTCAAGTTTTCGGTAGACCACCATACGTTGAAAGTAATCGCGG
CCGATCTAGTTCCCATCAAGCCCTACTCGACCAAGGTAATTAATATCAGTATGGGCCAGAGGTATGATATCGTCC
TGACTGCCAACCAAGGACACTTCGCACGGAATTTCTGGATGAGGACTGTCCCGCAGGCTTGTTCTTTCAATCGTA
ACGCTCACCAGATCCGGGCGATAGTTCACTATGATGATGCGCTTTCGACGCCCTCGACTATCAGGTATCCGAGCG
TGCCTCTCTGCAAAGACGAGACGAGAAACCTGATCCCATATATTAAGAAGGGCTTTGGCAATGCCAATAGACAGA
GCTCAGAAATCGTGGCCATCAAGAAGCGCGGTCCTCTCTTCCACTGGACTCTAAATAGTACAGCGATGAGGCTCG
AATGGGGCAATCCGACTTTAAAGAAAATCATGGACCGCAACCCTGCTTTCCGTCGGAGCAATGCCGTCATCGAGC
TGCCAGAGCCCAACATTATGTTTGCTATGGTTATACAGACTTACCTCCCCGTCCCTCACCCGATTCACTTACATG
GCCACGACTTTTACATCTTGGCTCAAGGTGTTGGTGTCTATTCACACAACCGCGTGCAGCTGAATCACATCAACC
CTCCCCGCCGAGATACGGCAATTCTGCCGGCTTTGGGATACCTTGTCATTGCATTCGAGACGGACAATCCCGGAG
CGTGGTTGATGCACTGCCACATCGGTTTTCACCTCAATGACGGATTCGGCCTTCAGTTCATCGAGCGCGCTAGGG
AGATACCGGCGATCATTGATAGGGCTCTTCTTGATAGCGGGTGCGCTGCGTGGAGGTCTTTCCAGGCCCTTAATT
CCATTAATCAGGATGACTCTGGTGTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail