Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9619
Gene name
LocationContig_71:22511..23336
Strand-
Gene length (bp)825
Transcript length (bp)825
Coding sequence length (bp)825
Protein length (aa) 275

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13649 Methyltransf_25 Methyltransferase domain 1.2E-13 46 141
PF13847 Methyltransf_31 Methyltransferase domain 1.2E-11 44 147
PF08241 Methyltransf_11 Methyltransferase domain 1.6E-10 47 136
PF13489 Methyltransf_23 Methyltransferase domain 2.6E-09 29 148
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 3.0E-09 4 136
PF08242 Methyltransf_12 Methyltransferase domain 1.6E-07 47 134
PF05175 MTS Methyltransferase small domain 7.9E-05 37 115

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q24W96|MENG_DESHY Demethylmenaquinone methyltransferase OS=Desulfitobacterium hafniense (strain Y51) GN=menG PE=3 SV=1 3 136 3.0E-07

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9619
MPEHAYDTIGSRYDIIKAASFNKLERFNLKRSVQPLLQKDGTSASVLDMACGTGFYSHLLLEWGAEAVTGVDISA
PMLKCAEARLSRTSYASRARFLQGDGLEPRLYGAGFDLVVGSWFLNYAKDLDELTAMFRTISMNLAAHGVFVGIC
FHPTNDLESFAVGTNESPWRNSGVQYEYQHQLPGGIGYQIRIASFPPPGHPSPPDRVEFTSRHLRKCHYEEAARA
GGMNGKIEWRLCEFLGDEWRSELRLEGDDEAWRKLQQHPPLSILMVGRE*
Coding >Hirsu2|9619
ATGCCCGAACACGCGTACGACACCATTGGTTCTCGATATGATATCATCAAGGCAGCTTCGTTCAACAAGCTTGAA
CGCTTCAATCTCAAGAGAAGCGTCCAGCCACTGCTTCAAAAGGATGGCACATCCGCATCTGTACTCGACATGGCA
TGCGGAACTGGATTCTACTCCCACCTGCTGCTGGAATGGGGAGCCGAAGCGGTGACCGGGGTCGACATTTCCGCT
CCAATGCTCAAGTGCGCTGAAGCCCGTCTGAGCCGGACCTCCTACGCCTCGAGGGCACGGTTCTTGCAGGGCGAT
GGCCTCGAGCCGAGGTTGTACGGTGCCGGCTTCGACCTAGTTGTTGGCTCCTGGTTCCTGAACTACGCCAAAGAC
TTGGACGAGCTGACGGCCATGTTCCGAACCATCTCGATGAACCTGGCAGCCCACGGAGTCTTTGTCGGGATCTGT
TTCCACCCCACTAACGACCTGGAATCATTCGCAGTGGGCACTAACGAGAGCCCATGGCGCAACAGCGGCGTTCAG
TACGAATACCAGCACCAGCTGCCCGGCGGGATCGGATACCAGATACGGATAGCGAGCTTTCCCCCACCTGGGCAT
CCTAGTCCGCCTGACAGAGTCGAGTTTACTTCGCGCCACCTGAGGAAGTGCCATTATGAGGAAGCAGCACGTGCT
GGCGGGATGAATGGCAAGATCGAGTGGCGACTATGTGAGTTTCTCGGCGACGAGTGGCGGTCTGAGCTGCGCCTG
GAAGGGGACGACGAGGCTTGGCGCAAGCTGCAGCAGCATCCACCTCTGAGCATTTTGATGGTGGGGAGAGAATGA
Transcript >Hirsu2|9619
ATGCCCGAACACGCGTACGACACCATTGGTTCTCGATATGATATCATCAAGGCAGCTTCGTTCAACAAGCTTGAA
CGCTTCAATCTCAAGAGAAGCGTCCAGCCACTGCTTCAAAAGGATGGCACATCCGCATCTGTACTCGACATGGCA
TGCGGAACTGGATTCTACTCCCACCTGCTGCTGGAATGGGGAGCCGAAGCGGTGACCGGGGTCGACATTTCCGCT
CCAATGCTCAAGTGCGCTGAAGCCCGTCTGAGCCGGACCTCCTACGCCTCGAGGGCACGGTTCTTGCAGGGCGAT
GGCCTCGAGCCGAGGTTGTACGGTGCCGGCTTCGACCTAGTTGTTGGCTCCTGGTTCCTGAACTACGCCAAAGAC
TTGGACGAGCTGACGGCCATGTTCCGAACCATCTCGATGAACCTGGCAGCCCACGGAGTCTTTGTCGGGATCTGT
TTCCACCCCACTAACGACCTGGAATCATTCGCAGTGGGCACTAACGAGAGCCCATGGCGCAACAGCGGCGTTCAG
TACGAATACCAGCACCAGCTGCCCGGCGGGATCGGATACCAGATACGGATAGCGAGCTTTCCCCCACCTGGGCAT
CCTAGTCCGCCTGACAGAGTCGAGTTTACTTCGCGCCACCTGAGGAAGTGCCATTATGAGGAAGCAGCACGTGCT
GGCGGGATGAATGGCAAGATCGAGTGGCGACTATGTGAGTTTCTCGGCGACGAGTGGCGGTCTGAGCTGCGCCTG
GAAGGGGACGACGAGGCTTGGCGCAAGCTGCAGCAGCATCCACCTCTGAGCATTTTGATGGTGGGGAGAGAATGA
Gene >Hirsu2|9619
ATGCCCGAACACGCGTACGACACCATTGGTTCTCGATATGATATCATCAAGGCAGCTTCGTTCAACAAGCTTGAA
CGCTTCAATCTCAAGAGAAGCGTCCAGCCACTGCTTCAAAAGGATGGCACATCCGCATCTGTACTCGACATGGCA
TGCGGAACTGGATTCTACTCCCACCTGCTGCTGGAATGGGGAGCCGAAGCGGTGACCGGGGTCGACATTTCCGCT
CCAATGCTCAAGTGCGCTGAAGCCCGTCTGAGCCGGACCTCCTACGCCTCGAGGGCACGGTTCTTGCAGGGCGAT
GGCCTCGAGCCGAGGTTGTACGGTGCCGGCTTCGACCTAGTTGTTGGCTCCTGGTTCCTGAACTACGCCAAAGAC
TTGGACGAGCTGACGGCCATGTTCCGAACCATCTCGATGAACCTGGCAGCCCACGGAGTCTTTGTCGGGATCTGT
TTCCACCCCACTAACGACCTGGAATCATTCGCAGTGGGCACTAACGAGAGCCCATGGCGCAACAGCGGCGTTCAG
TACGAATACCAGCACCAGCTGCCCGGCGGGATCGGATACCAGATACGGATAGCGAGCTTTCCCCCACCTGGGCAT
CCTAGTCCGCCTGACAGAGTCGAGTTTACTTCGCGCCACCTGAGGAAGTGCCATTATGAGGAAGCAGCACGTGCT
GGCGGGATGAATGGCAAGATCGAGTGGCGACTATGTGAGTTTCTCGGCGACGAGTGGCGGTCTGAGCTGCGCCTG
GAAGGGGACGACGAGGCTTGGCGCAAGCTGCAGCAGCATCCACCTCTGAGCATTTTGATGGTGGGGAGAGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail