Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9610
Gene name
LocationContig_71:1312..3182
Strand+
Gene length (bp)1870
Transcript length (bp)1614
Coding sequence length (bp)1614
Protein length (aa) 538

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 5.7E-20 81 424

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C0V8|YHJ1_SCHPO Uncharacterized transporter PB10D8.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB10D8.01 PE=3 SV=1 38 537 2.0E-72
sp|Q9C0U9|YQD3_SCHPO Uncharacterized transporter PB1C11.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCPB1C11.03 PE=1 SV=1 9 537 3.0E-71
sp|Q12235|YCT1_YEAST High affinity cysteine transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCT1 PE=1 SV=1 45 537 1.0E-54
sp|O74923|YJ7D_SCHPO Uncharacterized transporter C757.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.13 PE=3 SV=1 83 535 3.0E-41
sp|B5BP49|YP55_SCHPO Uncharacterized transporter C460.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.05 PE=3 SV=1 4 535 6.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C0V8|YHJ1_SCHPO Uncharacterized transporter PB10D8.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB10D8.01 PE=3 SV=1 38 537 2.0E-72
sp|Q9C0U9|YQD3_SCHPO Uncharacterized transporter PB1C11.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCPB1C11.03 PE=1 SV=1 9 537 3.0E-71
sp|Q12235|YCT1_YEAST High affinity cysteine transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCT1 PE=1 SV=1 45 537 1.0E-54
sp|O74923|YJ7D_SCHPO Uncharacterized transporter C757.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.13 PE=3 SV=1 83 535 3.0E-41
sp|B5BP49|YP55_SCHPO Uncharacterized transporter C460.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.05 PE=3 SV=1 4 535 6.0E-33
sp|P15365|DAL5_YEAST Allantoate permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL5 PE=1 SV=1 89 537 8.0E-31
sp|Q07904|THI73_YEAST Thiamine pathway transporter THI73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI73 PE=1 SV=1 55 535 2.0E-28
sp|O94491|YC7A_SCHPO Uncharacterized transporter C417.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.10 PE=3 SV=1 89 537 4.0E-25
sp|O94572|YGDF_SCHPO Uncharacterized transporter C1773.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.15 PE=3 SV=1 88 513 1.0E-24
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 89 514 7.0E-23
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 58 510 8.0E-21
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 76 501 3.0E-20
sp|P53322|TNA1_YEAST High-affinity nicotinic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TNA1 PE=1 SV=1 33 506 3.0E-18
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 76 508 7.0E-15
sp|O43000|LIZ1_SCHPO Pantothenate transporter liz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=liz1 PE=2 SV=2 74 276 2.0E-14
sp|P70786|TUB3_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 44 289 3.0E-14
sp|Q44470|TUB4_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 85 276 5.0E-12
sp|P40445|YIQ6_YEAST Uncharacterized transporter YIL166C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL166C PE=1 SV=1 84 521 3.0E-11
sp|Q88FY6|NICT_PSEPK Putative metabolite transport protein NicT OS=Pseudomonas putida (strain KT2440) GN=nicT PE=2 SV=1 63 276 2.0E-08
sp|P25621|FEN2_YEAST Pantothenate transporter FEN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FEN2 PE=1 SV=1 81 287 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

Domain # Start End Length
1 113 132 19
2 142 161 19
3 202 224 22
4 239 261 22
5 370 392 22
6 465 487 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9610
MAFEKSGDEHVVESSNPGQGGEACQRVEAGRRRRLHMVTRRDIDDTTLFYNCHKDLVVPLDARGREELNRRNFWF
LLGQTWWIAFLIHLDKSTLSQASTMGIFRDVSMTKDEYNSLFVLFYTGYLVALWPGAAISQRVGHKHFITGSLLL
WALLLGLHPLARTGRQMMTLRFFLGMTESQIVPSTTVLHQAFFPPRTSPCVQLLWWASGTLANVLLTMVAFRLIQ
DDTHGGLVGGLKPWKWLHIICLVLTLLVSIFLIAFLPTSPVDAKWLSTEEKVHTIALIREAHAGISNSTFKWCQV
KECFLDAKSWLFILHMFFNELPNNTSQQLPLIVVGFGFTPAQSALLNIVKPLWGSVLVLISAAMLYRTNLGVGYT
CAISYIPCFVGGIIMVAAPWSNKVALVVGTQISTFKPSYLLGLSWAGTTTNGYTKRLCLMSTCVVAASVANMISP
EFWQEKYKPRYILPWSFMTAFWVISPGMCLLIRIYLVRQNEARARELDDSAEESDEDALDTTEGVLRLSAKDLDQ
TDRQNLRFVYPL*
Coding >Hirsu2|9610
ATGGCGTTTGAAAAAAGCGGCGACGAGCACGTCGTCGAGTCCTCCAATCCTGGACAAGGGGGCGAGGCATGCCAG
CGTGTCGAGGCCGGCCGGCGCCGCCGCCTCCACATGGTGACCAGGAGGGACATCGACGACACGACGCTCTTCTAC
AACTGCCACAAGGACCTTGTCGTCCCACTCGATGCCCGGGGCAGGGAAGAGCTGAACCGTCGAAACTTCTGGTTC
CTCCTGGGGCAGACCTGGTGGATCGCCTTCCTCATCCACCTCGACAAGTCGACCCTGTCGCAGGCCAGCACCATG
GGCATCTTCCGAGACGTCAGTATGACCAAGGACGAGTACAACAGCCTCTTCGTCCTCTTCTACACCGGCTACCTC
GTCGCCCTGTGGCCCGGCGCCGCCATCTCGCAGCGCGTGGGCCACAAGCACTTCATCACCGGCTCCTTGCTGCTC
TGGGCCCTGCTTCTCGGCCTGCACCCCCTCGCAAGGACGGGCCGGCAGATGATGACGCTTCGCTTCTTCCTAGGA
ATGACGGAATCGCAGATCGTGCCTTCGACAACAGTCCTCCACCAAGCCTTTTTCCCTCCCAGGACAAGCCCGTGT
GTGCAGCTGCTGTGGTGGGCCTCTGGCACCCTGGCAAACGTCCTGCTCACCATGGTGGCCTTCAGGCTCATCCAG
GATGACACGCATGGGGGCCTGGTTGGCGGTCTCAAGCCGTGGAAGTGGCTGCACATCATCTGCCTCGTCCTCACC
CTGCTCGTGTCCATCTTCCTCATCGCCTTCTTGCCTACTTCTCCCGTCGATGCCAAGTGGCTTTCGACTGAGGAA
AAGGTGCATACCATCGCCTTGATCCGGGAGGCCCATGCCGGCATCTCCAACTCCACCTTCAAATGGTGCCAGGTC
AAGGAATGCTTTCTCGACGCCAAGAGCTGGCTGTTCATACTCCACATGTTCTTCAACGAGCTGCCCAACAATACC
TCGCAGCAGCTGCCGCTCATCGTGGTTGGCTTCGGATTCACTCCGGCGCAGAGCGCGCTCCTCAACATCGTCAAG
CCGCTCTGGGGCTCCGTTCTTGTCCTCATTTCCGCAGCAATGCTCTACCGTACCAATCTCGGCGTGGGCTACACC
TGTGCCATATCTTATATCCCATGTTTCGTAGGGGGCATCATCATGGTCGCCGCTCCGTGGTCGAACAAGGTCGCC
CTCGTCGTCGGCACCCAAATCTCGACATTCAAGCCCTCGTATTTGCTTGGCCTTTCCTGGGCGGGGACTACCACC
AACGGATATACCAAGAGGCTTTGCTTGATGTCAACCTGCGTCGTCGCCGCTTCCGTGGCAAACATGATATCTCCA
GAGTTCTGGCAGGAGAAGTATAAGCCACGGTATATCCTGCCATGGTCTTTTATGACTGCCTTTTGGGTCATCTCT
CCCGGCATGTGTCTCCTTATCCGTATCTATCTGGTGCGACAGAATGAGGCTCGGGCGAGGGAGCTGGATGATAGT
GCCGAAGAGAGTGATGAGGATGCGCTCGATACGACAGAAGGCGTCTTGCGACTCAGCGCCAAGGATCTGGATCAG
ACCGACCGACAAAACCTCAGATTCGTTTACCCGCTGTGA
Transcript >Hirsu2|9610
ATGGCGTTTGAAAAAAGCGGCGACGAGCACGTCGTCGAGTCCTCCAATCCTGGACAAGGGGGCGAGGCATGCCAG
CGTGTCGAGGCCGGCCGGCGCCGCCGCCTCCACATGGTGACCAGGAGGGACATCGACGACACGACGCTCTTCTAC
AACTGCCACAAGGACCTTGTCGTCCCACTCGATGCCCGGGGCAGGGAAGAGCTGAACCGTCGAAACTTCTGGTTC
CTCCTGGGGCAGACCTGGTGGATCGCCTTCCTCATCCACCTCGACAAGTCGACCCTGTCGCAGGCCAGCACCATG
GGCATCTTCCGAGACGTCAGTATGACCAAGGACGAGTACAACAGCCTCTTCGTCCTCTTCTACACCGGCTACCTC
GTCGCCCTGTGGCCCGGCGCCGCCATCTCGCAGCGCGTGGGCCACAAGCACTTCATCACCGGCTCCTTGCTGCTC
TGGGCCCTGCTTCTCGGCCTGCACCCCCTCGCAAGGACGGGCCGGCAGATGATGACGCTTCGCTTCTTCCTAGGA
ATGACGGAATCGCAGATCGTGCCTTCGACAACAGTCCTCCACCAAGCCTTTTTCCCTCCCAGGACAAGCCCGTGT
GTGCAGCTGCTGTGGTGGGCCTCTGGCACCCTGGCAAACGTCCTGCTCACCATGGTGGCCTTCAGGCTCATCCAG
GATGACACGCATGGGGGCCTGGTTGGCGGTCTCAAGCCGTGGAAGTGGCTGCACATCATCTGCCTCGTCCTCACC
CTGCTCGTGTCCATCTTCCTCATCGCCTTCTTGCCTACTTCTCCCGTCGATGCCAAGTGGCTTTCGACTGAGGAA
AAGGTGCATACCATCGCCTTGATCCGGGAGGCCCATGCCGGCATCTCCAACTCCACCTTCAAATGGTGCCAGGTC
AAGGAATGCTTTCTCGACGCCAAGAGCTGGCTGTTCATACTCCACATGTTCTTCAACGAGCTGCCCAACAATACC
TCGCAGCAGCTGCCGCTCATCGTGGTTGGCTTCGGATTCACTCCGGCGCAGAGCGCGCTCCTCAACATCGTCAAG
CCGCTCTGGGGCTCCGTTCTTGTCCTCATTTCCGCAGCAATGCTCTACCGTACCAATCTCGGCGTGGGCTACACC
TGTGCCATATCTTATATCCCATGTTTCGTAGGGGGCATCATCATGGTCGCCGCTCCGTGGTCGAACAAGGTCGCC
CTCGTCGTCGGCACCCAAATCTCGACATTCAAGCCCTCGTATTTGCTTGGCCTTTCCTGGGCGGGGACTACCACC
AACGGATATACCAAGAGGCTTTGCTTGATGTCAACCTGCGTCGTCGCCGCTTCCGTGGCAAACATGATATCTCCA
GAGTTCTGGCAGGAGAAGTATAAGCCACGGTATATCCTGCCATGGTCTTTTATGACTGCCTTTTGGGTCATCTCT
CCCGGCATGTGTCTCCTTATCCGTATCTATCTGGTGCGACAGAATGAGGCTCGGGCGAGGGAGCTGGATGATAGT
GCCGAAGAGAGTGATGAGGATGCGCTCGATACGACAGAAGGCGTCTTGCGACTCAGCGCCAAGGATCTGGATCAG
ACCGACCGACAAAACCTCAGATTCGTTTACCCGCTGTGA
Gene >Hirsu2|9610
ATGGCGTTTGAAAAAAGCGGCGACGAGCACGTCGTCGAGTCCTCCAATCCTGGACAAGGGGGCGAGGCATGCCAG
CGTGTCGAGGCCGGCCGGCGCCGCCGCCTCCACATGGTGACCAGGAGGGACATCGACGACACGACGCTCTTCTAC
AACTGCCACAAGGACCTTGTCGTCCCACTCGATGCCCGGGGCAGGGAAGAGCTGAACCGTCGAAACTTCTGGTTC
CTCCTGGGGCAGACCTGGTGGATCGCCTTCCTCATCCACCTCGACAAGTCGACCCTGTCGCAGGCCAGCACCATG
GGCATCTTCCGAGACGTCAGTATGACCAAGGACGAGTACAACAGCCTCTTCGTCCTCTTCTACACCGGCTACCTC
GTCGCCCTGTGGCCCGGCGCCGCCATCTCGCAGCGCGTGGGCCACAAGCACTTCATCACCGGCTCCTTGCTGCTC
TGGGCCCTGCTTCTCGGCCTGCACCCCCTCGCAAGGACGGGCCGGCAGATGATGACGCTTCGCTTCTTCCTAGGA
ATGGTTGGTTGCTGCTGCGTCCTTCTGCTCCCACTGCCGCTTTCTCTGACCGCGCAGACGTTGGCCAGACGGAAT
CGCAGATCGTGCCTTCGACAACAGTCCTCCACCAAGCCTTTTTCCCTCCCAGGACAAGCCCGTGTGTGCAGCTGC
TGTGGTGGGCCTCTGGCACCCTGGCAAACGTCCTGCTCACCATGGTGGCCTTCAGGCTCATCCAGGATGACACGC
ATGGGGGCCTGGTTGGCGGTCTCAAGCCGTGGAAGTGGCTGCACATCATCTGCCTCGTCCTCACCCTGCTCGTGT
CCATCTTCCTCATCGCCTTCTTGCCTACTTCTCCCGTCGATGCCAAGTGGCTTTCGACTGAGGAAAAGGTGCATA
CCATCGCCTTGATCCGGGAGGCCCATGCCGGCATCTCCAACTCCACCTTCAAATGGTGCCAGGTCAAGGAATGCT
TTCTCGACGCCAAGAGCTGGCTGTTCATGCACGCCTCCCCTCATCCGCTCGTGTTGGCCTGAGCTCGCTGACGTC
GCGAGCCAGACTCCACATGTTCTTCAACGAGCTGCCCAACAATACCTCGCAGCAGCTGCCGCTCATCGTGGTTGG
CTTCGGATTCACTCCGGCGCAGAGCGCGCTCCTCAACATCGTCAAGCCGCTCTGGGGCTCCGTTCTTGTCCTCAT
TTCCGCAGCAATGCTCTACCGTACCAATCTCGGCGTGGGCTACACCTGTGCCATATCTTATATCCCATGTTTCGT
AGGGGGCATCATCATGGTGGGCGGCGGCCTTTGAGCCAAGTGCCAATTTTCTTGCCCTTGTTGCTGACTGGGTTT
CTTGGCTTGCCAGGTCGCCGCTCCGTGGTCGAACAAGGTCGCCCTCGTCGTCGGCACCCAAATCTCGACATTCAA
GCCCTCGTATTTGCTTGGCCTTTCCTGGGCGGGGACTACCACCAACGGATATACCAAGAGGCTTTGCTTGATGTC
AACCTGCGTCGTCGCCGCTTCCGTGGCAAACATGATATCTCCAGAGTAAGTTGCTGGGCCACGCTCCCATGCGCG
ATTCCAAGTGCTGAGAACGCCTGCCCTGGTTAGGTTCTGGCAGGAGAAGTATAAGCCACGGTATATCCTGCCATG
GTCTTTTATGACTGCCTTTTGGGTCATCTCTCCCGGCATGTGTCTCCTTATCCGTATCTATCTGGTGCGACAGAA
TGAGGCTCGGGCGAGGGAGCTGGATGATAGTGCCGAAGAGAGTGATGAGGATGCGCTCGATACGACAGAAGGCGT
CTTGCGACTCAGCGCCAAGGATCTGGATCAGACCGACCGACAAAACCTCAGATTCGTTTACCCGCTGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail