Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9607
Gene name
LocationContig_709:7383..8342
Strand+
Gene length (bp)959
Transcript length (bp)612
Coding sequence length (bp)612
Protein length (aa) 204

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01251 Ribosomal_S7e Ribosomal protein S7e 5.3E-81 13 195

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O43105|RS7_NEUCR 40S ribosomal protein S7 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crp-15 PE=3 SV=2 1 203 2.0E-121
sp|P62083|RS7_RAT 40S ribosomal protein S7 OS=Rattus norvegicus GN=Rps7 PE=1 SV=1 14 197 4.0E-76
sp|P62082|RS7_MOUSE 40S ribosomal protein S7 OS=Mus musculus GN=Rps7 PE=2 SV=1 14 197 4.0E-76
sp|P62081|RS7_HUMAN 40S ribosomal protein S7 OS=Homo sapiens GN=RPS7 PE=1 SV=1 14 197 4.0E-76
sp|Q5RT64|RS7_FELCA 40S ribosomal protein S7 OS=Felis catus GN=RPS7 PE=2 SV=1 14 197 4.0E-76
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O43105|RS7_NEUCR 40S ribosomal protein S7 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crp-15 PE=3 SV=2 1 203 2.0E-121
sp|P62083|RS7_RAT 40S ribosomal protein S7 OS=Rattus norvegicus GN=Rps7 PE=1 SV=1 14 197 4.0E-76
sp|P62082|RS7_MOUSE 40S ribosomal protein S7 OS=Mus musculus GN=Rps7 PE=2 SV=1 14 197 4.0E-76
sp|P62081|RS7_HUMAN 40S ribosomal protein S7 OS=Homo sapiens GN=RPS7 PE=1 SV=1 14 197 4.0E-76
sp|Q5RT64|RS7_FELCA 40S ribosomal protein S7 OS=Felis catus GN=RPS7 PE=2 SV=1 14 197 4.0E-76
sp|A6H769|RS7_BOVIN 40S ribosomal protein S7 OS=Bos taurus GN=RPS7 PE=2 SV=1 14 197 4.0E-76
sp|Q10101|RS7_SCHPO 40S ribosomal protein S7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps7 PE=1 SV=2 5 200 2.0E-75
sp|P02362|RS7_XENLA 40S ribosomal protein S7 OS=Xenopus laevis GN=rps7 PE=2 SV=2 14 197 1.0E-74
sp|P50894|RS7_TAKRU 40S ribosomal protein S7 OS=Takifugu rubripes GN=rps7 PE=3 SV=1 14 197 9.0E-73
sp|Q90YR7|RS7_ICTPU 40S ribosomal protein S7 OS=Ictalurus punctatus GN=rps7 PE=2 SV=1 17 197 5.0E-72
sp|P62084|RS7_DANRE 40S ribosomal protein S7 OS=Danio rerio GN=rps7 PE=2 SV=1 14 197 3.0E-71
sp|P26786|RS7A_YEAST 40S ribosomal protein S7-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS7A PE=1 SV=4 17 199 8.0E-71
sp|P48164|RS7B_YEAST 40S ribosomal protein S7-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS7B PE=1 SV=1 17 199 3.0E-69
sp|Q9VA91|RS7_DROME 40S ribosomal protein S7 OS=Drosophila melanogaster GN=RpS7 PE=1 SV=1 14 198 4.0E-66
sp|Q962S0|RS7_SPOFR 40S ribosomal protein S7 OS=Spodoptera frugiperda GN=RpS7 PE=2 SV=1 15 197 5.0E-66
sp|P62085|RS7_DROYA 40S ribosomal protein S7 OS=Drosophila yakuba GN=RpS7 PE=2 SV=1 14 198 2.0E-65
sp|P48155|RS7_MANSE 40S ribosomal protein S7 OS=Manduca sexta GN=RpS7 PE=2 SV=1 22 197 3.0E-65
sp|Q9NB21|RS7_CULQU 40S ribosomal protein S7 OS=Culex quinquefasciatus GN=RpS7 PE=2 SV=1 19 197 4.0E-64
sp|P33514|RS7_ANOGA 40S ribosomal protein S7 OS=Anopheles gambiae GN=RpS7 PE=2 SV=2 19 198 5.0E-64
sp|Q23312|RS7_CAEEL 40S ribosomal protein S7 OS=Caenorhabditis elegans GN=rps-7 PE=3 SV=1 20 196 8.0E-63
sp|Q9ZNS1|RS7_AVIMR 40S ribosomal protein S7 OS=Avicennia marina GN=RPS7 PE=2 SV=1 5 196 1.0E-54
sp|Q9XET4|RS7_SECCE 40S ribosomal protein S7 OS=Secale cereale GN=RPS7 PE=2 SV=1 19 201 1.0E-52
sp|Q54I41|RS7_DICDI 40S ribosomal protein S7 OS=Dictyostelium discoideum GN=rps7 PE=1 SV=1 14 200 1.0E-52
sp|Q8LJU5|RS7_ORYSJ 40S ribosomal protein S7 OS=Oryza sativa subsp. japonica GN=RPS7 PE=2 SV=2 19 201 3.0E-52
sp|Q9C514|RS71_ARATH 40S ribosomal protein S7-1 OS=Arabidopsis thaliana GN=RPS7A PE=2 SV=1 20 200 1.0E-51
sp|Q8LD03|RS73_ARATH 40S ribosomal protein S7-3 OS=Arabidopsis thaliana GN=RPS7C PE=1 SV=2 5 196 3.0E-51
sp|Q9M885|RS72_ARATH 40S ribosomal protein S7-2 OS=Arabidopsis thaliana GN=RPS7B PE=2 SV=1 19 196 2.0E-50
sp|Q9XH45|RS7_BRAOL 40S ribosomal protein S7 OS=Brassica oleracea GN=RPS7 PE=2 SV=1 19 196 4.0E-50
sp|Q949H0|RS7_HORVU 40S ribosomal protein S7 OS=Hordeum vulgare GN=RPS7 PE=2 SV=1 19 201 1.0E-48
sp|P47839|RS7_SALSA 40S ribosomal protein S7 (Fragment) OS=Salmo salar GN=rps7 PE=2 SV=1 102 135 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006412 translation Yes
GO:0003735 structural constituent of ribosome Yes
GO:0005840 ribosome Yes
GO:0034645 cellular macromolecule biosynthetic process No
GO:0008150 biological_process No
GO:0043228 non-membrane-bounded organelle No
GO:0009058 biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0043226 organelle No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0019538 protein metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0009059 macromolecule biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0043229 intracellular organelle No
GO:0044260 cellular macromolecule metabolic process No
GO:0009987 cellular process No
GO:0043043 peptide biosynthetic process No
GO:0005198 structural molecule activity No
GO:0006807 nitrogen compound metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0044238 primary metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0110165 cellular anatomical entity No
GO:0003674 molecular_function No
GO:1901576 organic substance biosynthetic process No
GO:0005575 cellular_component No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006518 peptide metabolic process No
GO:0043604 amide biosynthetic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.4676 0.4385 0.0354 0.0468 0.5669 0.0901 0.0271 0.061 0.0382 0.0068

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4579
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1535
Ophiocordyceps australis map64 (Brazil) OphauB2|4013
Ophiocordyceps camponoti-floridani Ophcf2|06991
Ophiocordyceps camponoti-rufipedis Ophun1|658
Ophiocordyceps kimflemingae Ophio5|6664
Ophiocordyceps subramaniannii Hirsu2|9607 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9607
MSAQALNKIAPNSPSRQNPSELEQSISQALYDLETNTADLKIALRPLQIVSAREIEVGHGKKAIVIFVPVPSLTG
FHKVQQRLTRELEKKFSDRHVLILASRRILPRPKRSARSRNTQKQKRPRSRTLTAVHDAILADLCYPVEIVGKRI
RTKEDGSKLLKVVLDEKERGGVDYRLDTYSEVYRRLTGRNVNFEFPQSSAAEY*
Coding >Hirsu2|9607
ATGAGCGCCCAGGCCCTGAACAAGATCGCCCCCAACAGCCCTTCGCGGCAAAACCCGTCGGAGCTCGAGCAGAGC
ATCTCGCAGGCTCTCTACGACCTCGAGACCAACACTGCCGACCTCAAGATCGCCCTGCGTCCTCTGCAGATCGTC
TCTGCCCGCGAGATCGAAGTTGGCCACGGCAAGAAGGCAATTGTCATCTTTGTCCCCGTCCCTTCCCTGACCGGC
TTCCACAAGGTTCAGCAGCGCCTGACCCGTGAGCTCGAGAAGAAGTTCTCGGACCGACATGTCCTGATCCTCGCC
TCGCGCCGCATCCTGCCCCGGCCCAAGCGCTCCGCCCGGTCGCGCAACACGCAGAAGCAGAAGCGTCCCCGCTCG
CGCACCCTGACGGCCGTCCACGACGCCATCCTGGCCGACCTGTGCTACCCCGTCGAGATCGTCGGCAAGCGCATC
CGCACCAAGGAGGACGGCAGCAAGCTGCTCAAGGTCGTGCTGGACGAGAAGGAGCGCGGCGGCGTCGACTACAGG
CTCGACACGTACTCCGAGGTCTACCGCCGCCTGACGGGCCGCAACGTCAACTTCGAGTTCCCCCAGAGCAGCGCC
GCCGAATACTAG
Transcript >Hirsu2|9607
ATGAGCGCCCAGGCCCTGAACAAGATCGCCCCCAACAGCCCTTCGCGGCAAAACCCGTCGGAGCTCGAGCAGAGC
ATCTCGCAGGCTCTCTACGACCTCGAGACCAACACTGCCGACCTCAAGATCGCCCTGCGTCCTCTGCAGATCGTC
TCTGCCCGCGAGATCGAAGTTGGCCACGGCAAGAAGGCAATTGTCATCTTTGTCCCCGTCCCTTCCCTGACCGGC
TTCCACAAGGTTCAGCAGCGCCTGACCCGTGAGCTCGAGAAGAAGTTCTCGGACCGACATGTCCTGATCCTCGCC
TCGCGCCGCATCCTGCCCCGGCCCAAGCGCTCCGCCCGGTCGCGCAACACGCAGAAGCAGAAGCGTCCCCGCTCG
CGCACCCTGACGGCCGTCCACGACGCCATCCTGGCCGACCTGTGCTACCCCGTCGAGATCGTCGGCAAGCGCATC
CGCACCAAGGAGGACGGCAGCAAGCTGCTCAAGGTCGTGCTGGACGAGAAGGAGCGCGGCGGCGTCGACTACAGG
CTCGACACGTACTCCGAGGTCTACCGCCGCCTGACGGGCCGCAACGTCAACTTCGAGTTCCCCCAGAGCAGCGCC
GCCGAATACTAG
Gene >Hirsu2|9607
ATGAGCGCCCAGGCCCTGAACAAGATCGCCCCCAACAGCCCTTCGCGGCAAAACCCGTCGGAGCTCGAGCAGAGC
ATCTCGCAGGCTCTCTACGACCTCGAGACCAACACTGCCGACCTCAAGATCGCCCTGCGTCCTCTGCAGATCGTC
TCTGCCCGCGAGGTGAGAAACTCCGTGTGAGCGCGATGCTCAGAACGCGCGAGGCCCGACCCGGCCCGACCCTCC
GCGGGATCCTGTTCCAGGCGAACCATGGCGACCGGCTCGTCTTGTCGCGAGCGCACGAGCCGACGCGAGACCGAT
CGACGCACACACGGGCTGGGACGACGCCCTCGGTCGCCAGGCGCACAAGTGTCGTCTCGATCGCATATGGAACAG
GACGGGAAGCGGTCCAAGGCTTAGTCCTGGAGCTCGCCTGCTGACTCGAGGTCTTTGATTAGATCGAAGTTGGCC
ACGGCAAGAAGGCAATTGTCATCTTTGTCCCCGTCCCTTCCCTGACCGGCTTCCACAAGGTTCAGCAGCGGTAAG
TCTGGCCAAGCTCGTGCTGCGTGACGACGGGCGAGTCCGATTGGGGGCTGACACGGCACAATTCTAGCCTGACCC
GTGAGCTCGAGAAGAAGTTCTCGGACCGACATGTCCTGATCCTCGCCTCGCGCCGCATCCTGCCCCGGCCCAAGC
GCTCCGCCCGGTCGCGCAACACGCAGAAGCAGAAGCGTCCCCGCTCGCGCACCCTGACGGCCGTCCACGACGCCA
TCCTGGCCGACCTGTGCTACCCCGTCGAGATCGTCGGCAAGCGCATCCGCACCAAGGAGGACGGCAGCAAGCTGC
TCAAGGTCGTGCTGGACGAGAAGGAGCGCGGCGGCGTCGACTACAGGCTCGACACGTACTCCGAGGTCTACCGCC
GCCTGACGGGCCGCAACGTCAACTTCGAGTTCCCCCAGAGCAGCGCCGCCGAATACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail