Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9600
Gene name
LocationContig_708:2564..4079
Strand-
Gene length (bp)1515
Transcript length (bp)1515
Coding sequence length (bp)1515
Protein length (aa) 505

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Golgi apparatus Signal peptide|Transmembrane domain 0.1847 0.1461 0.3485 0.1755 0.1192 0.0087 0.502 0.184 0.8962 0.0058

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 13 32 19

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5778
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7469
Ophiocordyceps australis map64 (Brazil) OphauB2|6454
Ophiocordyceps camponoti-floridani Ophcf2|05163
Ophiocordyceps camponoti-rufipedis Ophun1|1088
Ophiocordyceps kimflemingae Ophio5|3430
Ophiocordyceps subramaniannii Hirsu2|9600 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9600
MISSTLSRSLRRAAAVLFVLCAAAVFLYRIAGLQVRLRGWTPTSALPADSDDSLAVQGDQIGTYAAELGRTYATE
LGRKFRPAAAQRHERRVHLLVPANRANSRLCRTVASAIVNDYPAPVIINWGLEQGDEAMNGYDMVTGKNWGVLEY
LRELPATADDDIVIMVDAHDVIFQLPLQVLLGRYDDINAQATARLEKQHGREGLRADRIGQTIIMPSEKYCWPLD
HRHPSCYAVPESGLRPDAYGPETDRATETNRPRWLNSGVIMGPVGDMRELYEWAHVLWRAYDTQGGDQDYFSHIY
GVQELSRQRLRGSQDWAFGFGEHFKDDELWRPHMEARHRDYRLGLDLGSTAFQALNSAAGDLSAVVHGNATAVDA
RDREHGTADIYGAPFAFPDDLRGPLPAGFRARAPDDGAGPPGWRDVRLFSNFHARSVPALLHFNGDKTHMDDWWH
RQWWAGQGREMLQLRSSRPGFAIRPDNRSAHSVSMSWDDLCAPFEADVFVEPYD*
Coding >Hirsu2|9600
ATGATCTCCTCGACGCTGTCCCGTTCGCTGCGCCGTGCCGCCGCAGTGCTTTTCGTGCTGTGCGCCGCGGCCGTC
TTTCTATACCGAATAGCTGGCCTGCAGGTCCGTTTACGTGGCTGGACTCCAACGTCGGCTCTTCCCGCTGACTCG
GACGATTCGCTCGCCGTCCAGGGCGACCAGATCGGGACGTACGCGGCCGAGCTGGGCAGGACGTACGCCACGGAA
CTGGGCCGCAAGTTCAGGCCGGCGGCGGCACAGCGTCACGAGCGACGGGTCCATCTGCTGGTGCCCGCCAACCGG
GCCAACTCGCGGCTGTGCCGGACCGTGGCGAGCGCCATCGTCAACGACTACCCGGCGCCCGTCATCATCAACTGG
GGGCTGGAGCAGGGCGACGAGGCCATGAACGGGTACGACATGGTGACGGGCAAGAACTGGGGCGTGCTCGAGTAC
CTGCGCGAGCTGCCGGCGACGGCCGACGACGATATCGTCATCATGGTGGACGCGCACGACGTGATATTCCAGCTG
CCGCTCCAAGTGCTCCTGGGCCGGTACGACGACATCAACGCGCAGGCGACGGCGCGGCTGGAGAAGCAGCACGGG
CGCGAGGGTCTGCGGGCGGACCGGATCGGGCAGACGATCATCATGCCGTCGGAGAAGTACTGCTGGCCGCTCGAC
CACCGGCACCCGAGCTGCTACGCCGTGCCCGAGTCGGGGCTGCGGCCGGACGCGTACGGGCCCGAGACGGACCGG
GCGACGGAGACGAACCGGCCGCGCTGGCTCAACTCGGGCGTCATCATGGGCCCGGTCGGCGACATGCGCGAGCTG
TACGAGTGGGCGCACGTGCTGTGGCGCGCCTACGACACGCAAGGCGGCGACCAGGACTACTTCTCTCACATCTAC
GGCGTGCAGGAGCTGTCGCGGCAGCGGCTGCGCGGCAGCCAGGACTGGGCCTTTGGCTTCGGCGAGCACTTCAAG
GACGACGAGCTGTGGCGGCCGCACATGGAGGCCCGGCACCGCGACTACCGCCTCGGCCTCGACCTGGGCAGCACC
GCCTTCCAGGCGCTCAACAGCGCCGCCGGCGACCTGTCGGCCGTGGTGCACGGCAACGCCACCGCCGTCGACGCC
CGCGACCGCGAGCACGGCACCGCCGACATCTACGGCGCGCCCTTCGCCTTCCCGGACGACCTGCGCGGCCCGCTG
CCGGCCGGCTTCCGGGCCCGGGCCCCCGACGACGGCGCCGGCCCACCCGGCTGGCGCGACGTCCGCCTCTTCTCC
AACTTCCACGCCCGCTCCGTCCCGGCCCTGCTGCACTTCAACGGCGACAAGACGCACATGGACGACTGGTGGCAC
CGCCAGTGGTGGGCCGGCCAGGGGCGCGAGATGCTGCAGCTCCGCTCGAGCCGGCCCGGCTTCGCCATCCGCCCC
GACAACCGCTCCGCCCACTCTGTGTCCATGTCGTGGGACGACCTGTGCGCCCCGTTCGAGGCCGACGTCTTCGTC
GAGCCCTACGACTGA
Transcript >Hirsu2|9600
ATGATCTCCTCGACGCTGTCCCGTTCGCTGCGCCGTGCCGCCGCAGTGCTTTTCGTGCTGTGCGCCGCGGCCGTC
TTTCTATACCGAATAGCTGGCCTGCAGGTCCGTTTACGTGGCTGGACTCCAACGTCGGCTCTTCCCGCTGACTCG
GACGATTCGCTCGCCGTCCAGGGCGACCAGATCGGGACGTACGCGGCCGAGCTGGGCAGGACGTACGCCACGGAA
CTGGGCCGCAAGTTCAGGCCGGCGGCGGCACAGCGTCACGAGCGACGGGTCCATCTGCTGGTGCCCGCCAACCGG
GCCAACTCGCGGCTGTGCCGGACCGTGGCGAGCGCCATCGTCAACGACTACCCGGCGCCCGTCATCATCAACTGG
GGGCTGGAGCAGGGCGACGAGGCCATGAACGGGTACGACATGGTGACGGGCAAGAACTGGGGCGTGCTCGAGTAC
CTGCGCGAGCTGCCGGCGACGGCCGACGACGATATCGTCATCATGGTGGACGCGCACGACGTGATATTCCAGCTG
CCGCTCCAAGTGCTCCTGGGCCGGTACGACGACATCAACGCGCAGGCGACGGCGCGGCTGGAGAAGCAGCACGGG
CGCGAGGGTCTGCGGGCGGACCGGATCGGGCAGACGATCATCATGCCGTCGGAGAAGTACTGCTGGCCGCTCGAC
CACCGGCACCCGAGCTGCTACGCCGTGCCCGAGTCGGGGCTGCGGCCGGACGCGTACGGGCCCGAGACGGACCGG
GCGACGGAGACGAACCGGCCGCGCTGGCTCAACTCGGGCGTCATCATGGGCCCGGTCGGCGACATGCGCGAGCTG
TACGAGTGGGCGCACGTGCTGTGGCGCGCCTACGACACGCAAGGCGGCGACCAGGACTACTTCTCTCACATCTAC
GGCGTGCAGGAGCTGTCGCGGCAGCGGCTGCGCGGCAGCCAGGACTGGGCCTTTGGCTTCGGCGAGCACTTCAAG
GACGACGAGCTGTGGCGGCCGCACATGGAGGCCCGGCACCGCGACTACCGCCTCGGCCTCGACCTGGGCAGCACC
GCCTTCCAGGCGCTCAACAGCGCCGCCGGCGACCTGTCGGCCGTGGTGCACGGCAACGCCACCGCCGTCGACGCC
CGCGACCGCGAGCACGGCACCGCCGACATCTACGGCGCGCCCTTCGCCTTCCCGGACGACCTGCGCGGCCCGCTG
CCGGCCGGCTTCCGGGCCCGGGCCCCCGACGACGGCGCCGGCCCACCCGGCTGGCGCGACGTCCGCCTCTTCTCC
AACTTCCACGCCCGCTCCGTCCCGGCCCTGCTGCACTTCAACGGCGACAAGACGCACATGGACGACTGGTGGCAC
CGCCAGTGGTGGGCCGGCCAGGGGCGCGAGATGCTGCAGCTCCGCTCGAGCCGGCCCGGCTTCGCCATCCGCCCC
GACAACCGCTCCGCCCACTCTGTGTCCATGTCGTGGGACGACCTGTGCGCCCCGTTCGAGGCCGACGTCTTCGTC
GAGCCCTACGACTGA
Gene >Hirsu2|9600
ATGATCTCCTCGACGCTGTCCCGTTCGCTGCGCCGTGCCGCCGCAGTGCTTTTCGTGCTGTGCGCCGCGGCCGTC
TTTCTATACCGAATAGCTGGCCTGCAGGTCCGTTTACGTGGCTGGACTCCAACGTCGGCTCTTCCCGCTGACTCG
GACGATTCGCTCGCCGTCCAGGGCGACCAGATCGGGACGTACGCGGCCGAGCTGGGCAGGACGTACGCCACGGAA
CTGGGCCGCAAGTTCAGGCCGGCGGCGGCACAGCGTCACGAGCGACGGGTCCATCTGCTGGTGCCCGCCAACCGG
GCCAACTCGCGGCTGTGCCGGACCGTGGCGAGCGCCATCGTCAACGACTACCCGGCGCCCGTCATCATCAACTGG
GGGCTGGAGCAGGGCGACGAGGCCATGAACGGGTACGACATGGTGACGGGCAAGAACTGGGGCGTGCTCGAGTAC
CTGCGCGAGCTGCCGGCGACGGCCGACGACGATATCGTCATCATGGTGGACGCGCACGACGTGATATTCCAGCTG
CCGCTCCAAGTGCTCCTGGGCCGGTACGACGACATCAACGCGCAGGCGACGGCGCGGCTGGAGAAGCAGCACGGG
CGCGAGGGTCTGCGGGCGGACCGGATCGGGCAGACGATCATCATGCCGTCGGAGAAGTACTGCTGGCCGCTCGAC
CACCGGCACCCGAGCTGCTACGCCGTGCCCGAGTCGGGGCTGCGGCCGGACGCGTACGGGCCCGAGACGGACCGG
GCGACGGAGACGAACCGGCCGCGCTGGCTCAACTCGGGCGTCATCATGGGCCCGGTCGGCGACATGCGCGAGCTG
TACGAGTGGGCGCACGTGCTGTGGCGCGCCTACGACACGCAAGGCGGCGACCAGGACTACTTCTCTCACATCTAC
GGCGTGCAGGAGCTGTCGCGGCAGCGGCTGCGCGGCAGCCAGGACTGGGCCTTTGGCTTCGGCGAGCACTTCAAG
GACGACGAGCTGTGGCGGCCGCACATGGAGGCCCGGCACCGCGACTACCGCCTCGGCCTCGACCTGGGCAGCACC
GCCTTCCAGGCGCTCAACAGCGCCGCCGGCGACCTGTCGGCCGTGGTGCACGGCAACGCCACCGCCGTCGACGCC
CGCGACCGCGAGCACGGCACCGCCGACATCTACGGCGCGCCCTTCGCCTTCCCGGACGACCTGCGCGGCCCGCTG
CCGGCCGGCTTCCGGGCCCGGGCCCCCGACGACGGCGCCGGCCCACCCGGCTGGCGCGACGTCCGCCTCTTCTCC
AACTTCCACGCCCGCTCCGTCCCGGCCCTGCTGCACTTCAACGGCGACAAGACGCACATGGACGACTGGTGGCAC
CGCCAGTGGTGGGCCGGCCAGGGGCGCGAGATGCTGCAGCTCCGCTCGAGCCGGCCCGGCTTCGCCATCCGCCCC
GACAACCGCTCCGCCCACTCTGTGTCCATGTCGTGGGACGACCTGTGCGCCCCGTTCGAGGCCGACGTCTTCGTC
GAGCCCTACGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail