Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9596
Gene name
LocationContig_707:3740..5498
Strand-
Gene length (bp)1758
Transcript length (bp)1758
Coding sequence length (bp)1758
Protein length (aa) 586

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09286 Pro-kuma_activ Pro-kumamolisin, activation domain 1.8E-21 37 162
PF00082 Peptidase_S8 Subtilase family 1.9E-05 333 535

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q70J59|SED2_ASPFU Tripeptidyl-peptidase sed2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sed2 PE=1 SV=1 6 572 5.0E-109
sp|C5FTQ5|SED3_ARTOC Tripeptidyl-peptidase SED3 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SED3 PE=3 SV=1 5 581 2.0E-105
sp|D4ANG0|SED2_ARTBC Probable tripeptidyl-peptidase SED2 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SED2 PE=1 SV=1 3 581 3.0E-105
sp|D4DBH6|SED2_TRIVH Probable tripeptidyl-peptidase SED2 OS=Trichophyton verrucosum (strain HKI 0517) GN=SED2 PE=3 SV=1 3 581 7.0E-105
sp|Q70GH4|SED3_ASPFU Tripeptidyl-peptidase sed3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sed3 PE=1 SV=1 3 571 5.0E-104
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q70J59|SED2_ASPFU Tripeptidyl-peptidase sed2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sed2 PE=1 SV=1 6 572 5.0E-109
sp|C5FTQ5|SED3_ARTOC Tripeptidyl-peptidase SED3 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SED3 PE=3 SV=1 5 581 2.0E-105
sp|D4ANG0|SED2_ARTBC Probable tripeptidyl-peptidase SED2 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SED2 PE=1 SV=1 3 581 3.0E-105
sp|D4DBH6|SED2_TRIVH Probable tripeptidyl-peptidase SED2 OS=Trichophyton verrucosum (strain HKI 0517) GN=SED2 PE=3 SV=1 3 581 7.0E-105
sp|Q70GH4|SED3_ASPFU Tripeptidyl-peptidase sed3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sed3 PE=1 SV=1 3 571 5.0E-104
sp|C5FBW2|SED2_ARTOC Tripeptidyl-peptidase SED2 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SED2 PE=3 SV=1 3 581 5.0E-103
sp|C5FRX4|SED4_ARTOC Tripeptidyl-peptidase SED4 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SED4 PE=3 SV=1 1 583 7.0E-103
sp|Q4WQU0|SED4_ASPFU Tripeptidyl-peptidase sed4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sed4 PE=1 SV=1 12 581 2.0E-102
sp|D4AK75|SED3_ARTBC Probable tripeptidyl-peptidase SED3 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SED3 PE=3 SV=2 22 581 4.0E-99
sp|D4D7N6|SED3_TRIVH Probable tripeptidyl-peptidase SED3 OS=Trichophyton verrucosum (strain HKI 0517) GN=SED3 PE=3 SV=2 22 581 5.0E-98
sp|D4D9U2|SED4_TRIVH Probable tripeptidyl-peptidase SED4 OS=Trichophyton verrucosum (strain HKI 0517) GN=SED4 PE=3 SV=2 1 582 6.0E-96
sp|D4AIK6|SED4_ARTBC Probable tripeptidyl-peptidase SED4 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SED4 PE=1 SV=1 7 582 8.0E-95
sp|Q9XSB8|TPP1_CANLF Tripeptidyl-peptidase 1 OS=Canis lupus familiaris GN=TPP1 PE=3 SV=1 1 583 3.0E-53
sp|O14773|TPP1_HUMAN Tripeptidyl-peptidase 1 OS=Homo sapiens GN=TPP1 PE=1 SV=2 2 582 7.0E-53
sp|Q60HH1|TPP1_MACFA Tripeptidyl-peptidase 1 OS=Macaca fascicularis GN=TPP1 PE=2 SV=2 2 582 9.0E-53
sp|Q5IS74|TPP1_PANTR Tripeptidyl-peptidase 1 OS=Pan troglodytes GN=TPP1 PE=2 SV=1 2 582 1.0E-52
sp|Q9EQV6|TPP1_RAT Tripeptidyl-peptidase 1 OS=Rattus norvegicus GN=Tpp1 PE=1 SV=1 9 583 2.0E-52
sp|Q0V8B6|TPP1_BOVIN Tripeptidyl-peptidase 1 OS=Bos taurus GN=TPP1 PE=2 SV=1 6 583 3.0E-52
sp|O89023|TPP1_MOUSE Tripeptidyl-peptidase 1 OS=Mus musculus GN=Tpp1 PE=1 SV=2 6 583 6.0E-51
sp|Q5RFL1|TPP1_PONAB Tripeptidyl-peptidase 1 OS=Pongo abelii GN=TPP1 PE=2 SV=1 2 582 1.0E-50
sp|Q70DX9|SED1_ASPFU Tripeptidyl-peptidase sed1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sed1 PE=1 SV=1 5 572 5.0E-47
sp|Q8NK92|AORSN_ASPOR Aorsin OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=aorO PE=1 SV=2 72 572 7.0E-47
sp|Q55CT0|TPP1_DICDI Tripeptidyl-peptidase 1 OS=Dictyostelium discoideum GN=tpp1 PE=3 SV=1 72 572 9.0E-40
sp|C5FHK0|SED1_ARTOC Tripeptidyl-peptidase SED1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SED1 PE=3 SV=1 22 581 2.0E-39
sp|Q8MZS4|PHYSA_PHYPO Physarolisin OS=Physarum polycephalum PE=1 SV=1 74 571 2.0E-31
sp|Q4WGU1|SED5_ASPFU Tripeptidyl-peptidase sed5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sed5 PE=3 SV=2 318 580 9.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0004252 serine-type endopeptidase activity Yes
GO:0008236 serine-type peptidase activity Yes
GO:0006807 nitrogen compound metabolic process No
GO:0016787 hydrolase activity No
GO:0044238 primary metabolic process No
GO:0008233 peptidase activity No
GO:0003824 catalytic activity No
GO:0004175 endopeptidase activity No
GO:0071704 organic substance metabolic process No
GO:0070011 peptidase activity, acting on L-amino acid peptides No
GO:0003674 molecular_function No
GO:0019538 protein metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:1901564 organonitrogen compound metabolic process No
GO:0017171 serine hydrolase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9596
MALRLLVGACALAGLGAGAASVEKAHVIPDGWQQLADAPDPAQPMRMSLALRHANADGLTSSIRSSLRDGLSLDD
VARLRTPEQRDVGSVHRWLAGNGITHARTDKDWVHVHTTVGQAEKLLRTRLHRYSYQGKPAVLRTREYFIPDELA
HVVRFVHPVANFMTPEHDVAASRIIDHRPAVVHRRDECSQLITPDCILDAYKMRYKGSDGRSRARLAVAGFLDQF
ANYADTDQFLGRYAPALAHSGYNFSVELVGGGTNPQDRAKAGSEANLDIQYALAVGYPSHITYYSTGGRGVKLND
SGLPYPEEYSDNEPYLELVEHLLAKPDDELPHVLTMSYADDELSVPRPYAERVCDLFGLLTGRGTSVIVASGDGG
AQGGRNAKCQTNDGKARQTAMATFPGTCPWVTAVGAVTNSDSPPHGALFSTGGFSQWFDRPHWQDRAVDGYVEAL
HGHMQQFYDAKKRAIPDISCVGTHFTTIVGGDEVALDGTSASAPVFAAMIARANDARLRHGKRPLGWLNERLYSD
EVRRVLQDTTEGRSKSCTFQTPSGPWTPGGWPAKPGWDAITGLGVPNDFKTFERVLVQGY*
Coding >Hirsu2|9596
ATGGCTCTGAGGCTCCTCGTCGGCGCCTGCGCCTTGGCCGGCCTCGGCGCCGGCGCCGCCTCTGTCGAAAAGGCG
CACGTCATCCCCGACGGCTGGCAGCAGCTGGCCGACGCGCCCGACCCGGCCCAGCCGATGCGCATGTCGCTGGCC
CTCCGCCACGCCAACGCCGACGGCCTGACGTCGTCTATCCGGTCCTCGCTCCGCGACGGCCTCTCGCTCGACGAC
GTCGCCAGGCTGCGGACGCCCGAGCAGCGCGACGTCGGCAGCGTGCACCGCTGGCTGGCCGGCAACGGCATCACC
CACGCCCGGACCGACAAGGACTGGGTCCACGTGCACACGACGGTCGGCCAGGCCGAGAAGCTGCTGAGGACCAGG
CTGCACCGCTACTCGTACCAGGGCAAGCCGGCTGTCTTGCGCACGCGCGAGTACTTCATCCCCGACGAGCTCGCC
CACGTCGTCCGCTTCGTCCACCCCGTCGCCAACTTCATGACGCCCGAGCACGACGTGGCCGCCAGCCGCATCATC
GACCACCGGCCGGCCGTCGTCCACCGCCGCGACGAGTGCTCGCAGCTCATCACGCCCGACTGCATCCTCGACGCC
TACAAGATGCGCTACAAGGGCTCCGACGGCAGGTCGCGCGCTCGCCTGGCCGTCGCCGGCTTCCTCGACCAGTTC
GCCAACTACGCCGACACGGACCAGTTCCTCGGCCGCTACGCCCCGGCCCTCGCCCACAGCGGCTACAACTTCTCC
GTCGAGCTGGTCGGCGGCGGCACGAACCCGCAGGACCGCGCCAAGGCCGGCTCCGAGGCCAACCTCGACATCCAG
TACGCCCTGGCCGTCGGCTACCCCAGCCACATCACCTACTACTCCACCGGCGGCCGCGGCGTCAAGCTCAACGAC
TCGGGCCTGCCGTACCCCGAGGAGTACTCGGACAACGAGCCGTACCTCGAGCTGGTCGAGCACCTGCTGGCCAAG
CCCGACGACGAGCTGCCGCACGTGCTGACCATGTCGTATGCCGACGACGAGCTGTCGGTGCCGCGGCCCTACGCC
GAGCGCGTCTGTGATCTGTTCGGCCTGCTGACCGGCCGCGGCACCTCCGTCATCGTCGCCTCGGGCGACGGCGGC
GCCCAGGGCGGCCGCAACGCCAAGTGCCAGACCAACGACGGCAAGGCCCGCCAGACGGCCATGGCCACCTTCCCC
GGCACGTGCCCGTGGGTGACGGCGGTCGGGGCCGTGACCAACTCGGACTCGCCGCCGCACGGCGCCCTCTTCAGC
ACCGGCGGCTTCTCCCAGTGGTTCGACCGGCCGCACTGGCAGGACCGGGCCGTCGACGGCTACGTCGAGGCCCTG
CACGGTCACATGCAGCAGTTCTACGACGCCAAGAAGCGCGCCATCCCCGACATCTCGTGCGTCGGCACCCACTTC
ACCACCATCGTCGGCGGCGACGAGGTGGCCCTCGACGGCACCAGCGCCAGCGCGCCCGTCTTCGCCGCCATGATC
GCCCGCGCCAACGACGCGCGCCTGCGCCACGGCAAGCGCCCGCTCGGCTGGCTCAACGAGAGGCTGTACTCGGAC
GAGGTCCGCCGCGTCCTCCAGGACACCACCGAGGGCCGCAGCAAGTCGTGCACCTTCCAGACGCCCAGCGGGCCC
TGGACTCCCGGCGGCTGGCCCGCCAAGCCGGGCTGGGACGCCATCACCGGCCTGGGCGTGCCCAACGATTTCAAG
ACGTTTGAGCGCGTCCTCGTCCAGGGATACTGA
Transcript >Hirsu2|9596
ATGGCTCTGAGGCTCCTCGTCGGCGCCTGCGCCTTGGCCGGCCTCGGCGCCGGCGCCGCCTCTGTCGAAAAGGCG
CACGTCATCCCCGACGGCTGGCAGCAGCTGGCCGACGCGCCCGACCCGGCCCAGCCGATGCGCATGTCGCTGGCC
CTCCGCCACGCCAACGCCGACGGCCTGACGTCGTCTATCCGGTCCTCGCTCCGCGACGGCCTCTCGCTCGACGAC
GTCGCCAGGCTGCGGACGCCCGAGCAGCGCGACGTCGGCAGCGTGCACCGCTGGCTGGCCGGCAACGGCATCACC
CACGCCCGGACCGACAAGGACTGGGTCCACGTGCACACGACGGTCGGCCAGGCCGAGAAGCTGCTGAGGACCAGG
CTGCACCGCTACTCGTACCAGGGCAAGCCGGCTGTCTTGCGCACGCGCGAGTACTTCATCCCCGACGAGCTCGCC
CACGTCGTCCGCTTCGTCCACCCCGTCGCCAACTTCATGACGCCCGAGCACGACGTGGCCGCCAGCCGCATCATC
GACCACCGGCCGGCCGTCGTCCACCGCCGCGACGAGTGCTCGCAGCTCATCACGCCCGACTGCATCCTCGACGCC
TACAAGATGCGCTACAAGGGCTCCGACGGCAGGTCGCGCGCTCGCCTGGCCGTCGCCGGCTTCCTCGACCAGTTC
GCCAACTACGCCGACACGGACCAGTTCCTCGGCCGCTACGCCCCGGCCCTCGCCCACAGCGGCTACAACTTCTCC
GTCGAGCTGGTCGGCGGCGGCACGAACCCGCAGGACCGCGCCAAGGCCGGCTCCGAGGCCAACCTCGACATCCAG
TACGCCCTGGCCGTCGGCTACCCCAGCCACATCACCTACTACTCCACCGGCGGCCGCGGCGTCAAGCTCAACGAC
TCGGGCCTGCCGTACCCCGAGGAGTACTCGGACAACGAGCCGTACCTCGAGCTGGTCGAGCACCTGCTGGCCAAG
CCCGACGACGAGCTGCCGCACGTGCTGACCATGTCGTATGCCGACGACGAGCTGTCGGTGCCGCGGCCCTACGCC
GAGCGCGTCTGTGATCTGTTCGGCCTGCTGACCGGCCGCGGCACCTCCGTCATCGTCGCCTCGGGCGACGGCGGC
GCCCAGGGCGGCCGCAACGCCAAGTGCCAGACCAACGACGGCAAGGCCCGCCAGACGGCCATGGCCACCTTCCCC
GGCACGTGCCCGTGGGTGACGGCGGTCGGGGCCGTGACCAACTCGGACTCGCCGCCGCACGGCGCCCTCTTCAGC
ACCGGCGGCTTCTCCCAGTGGTTCGACCGGCCGCACTGGCAGGACCGGGCCGTCGACGGCTACGTCGAGGCCCTG
CACGGTCACATGCAGCAGTTCTACGACGCCAAGAAGCGCGCCATCCCCGACATCTCGTGCGTCGGCACCCACTTC
ACCACCATCGTCGGCGGCGACGAGGTGGCCCTCGACGGCACCAGCGCCAGCGCGCCCGTCTTCGCCGCCATGATC
GCCCGCGCCAACGACGCGCGCCTGCGCCACGGCAAGCGCCCGCTCGGCTGGCTCAACGAGAGGCTGTACTCGGAC
GAGGTCCGCCGCGTCCTCCAGGACACCACCGAGGGCCGCAGCAAGTCGTGCACCTTCCAGACGCCCAGCGGGCCC
TGGACTCCCGGCGGCTGGCCCGCCAAGCCGGGCTGGGACGCCATCACCGGCCTGGGCGTGCCCAACGATTTCAAG
ACGTTTGAGCGCGTCCTCGTCCAGGGATACTGA
Gene >Hirsu2|9596
ATGGCTCTGAGGCTCCTCGTCGGCGCCTGCGCCTTGGCCGGCCTCGGCGCCGGCGCCGCCTCTGTCGAAAAGGCG
CACGTCATCCCCGACGGCTGGCAGCAGCTGGCCGACGCGCCCGACCCGGCCCAGCCGATGCGCATGTCGCTGGCC
CTCCGCCACGCCAACGCCGACGGCCTGACGTCGTCTATCCGGTCCTCGCTCCGCGACGGCCTCTCGCTCGACGAC
GTCGCCAGGCTGCGGACGCCCGAGCAGCGCGACGTCGGCAGCGTGCACCGCTGGCTGGCCGGCAACGGCATCACC
CACGCCCGGACCGACAAGGACTGGGTCCACGTGCACACGACGGTCGGCCAGGCCGAGAAGCTGCTGAGGACCAGG
CTGCACCGCTACTCGTACCAGGGCAAGCCGGCTGTCTTGCGCACGCGCGAGTACTTCATCCCCGACGAGCTCGCC
CACGTCGTCCGCTTCGTCCACCCCGTCGCCAACTTCATGACGCCCGAGCACGACGTGGCCGCCAGCCGCATCATC
GACCACCGGCCGGCCGTCGTCCACCGCCGCGACGAGTGCTCGCAGCTCATCACGCCCGACTGCATCCTCGACGCC
TACAAGATGCGCTACAAGGGCTCCGACGGCAGGTCGCGCGCTCGCCTGGCCGTCGCCGGCTTCCTCGACCAGTTC
GCCAACTACGCCGACACGGACCAGTTCCTCGGCCGCTACGCCCCGGCCCTCGCCCACAGCGGCTACAACTTCTCC
GTCGAGCTGGTCGGCGGCGGCACGAACCCGCAGGACCGCGCCAAGGCCGGCTCCGAGGCCAACCTCGACATCCAG
TACGCCCTGGCCGTCGGCTACCCCAGCCACATCACCTACTACTCCACCGGCGGCCGCGGCGTCAAGCTCAACGAC
TCGGGCCTGCCGTACCCCGAGGAGTACTCGGACAACGAGCCGTACCTCGAGCTGGTCGAGCACCTGCTGGCCAAG
CCCGACGACGAGCTGCCGCACGTGCTGACCATGTCGTATGCCGACGACGAGCTGTCGGTGCCGCGGCCCTACGCC
GAGCGCGTCTGTGATCTGTTCGGCCTGCTGACCGGCCGCGGCACCTCCGTCATCGTCGCCTCGGGCGACGGCGGC
GCCCAGGGCGGCCGCAACGCCAAGTGCCAGACCAACGACGGCAAGGCCCGCCAGACGGCCATGGCCACCTTCCCC
GGCACGTGCCCGTGGGTGACGGCGGTCGGGGCCGTGACCAACTCGGACTCGCCGCCGCACGGCGCCCTCTTCAGC
ACCGGCGGCTTCTCCCAGTGGTTCGACCGGCCGCACTGGCAGGACCGGGCCGTCGACGGCTACGTCGAGGCCCTG
CACGGTCACATGCAGCAGTTCTACGACGCCAAGAAGCGCGCCATCCCCGACATCTCGTGCGTCGGCACCCACTTC
ACCACCATCGTCGGCGGCGACGAGGTGGCCCTCGACGGCACCAGCGCCAGCGCGCCCGTCTTCGCCGCCATGATC
GCCCGCGCCAACGACGCGCGCCTGCGCCACGGCAAGCGCCCGCTCGGCTGGCTCAACGAGAGGCTGTACTCGGAC
GAGGTCCGCCGCGTCCTCCAGGACACCACCGAGGGCCGCAGCAAGTCGTGCACCTTCCAGACGCCCAGCGGGCCC
TGGACTCCCGGCGGCTGGCCCGCCAAGCCGGGCTGGGACGCCATCACCGGCCTGGGCGTGCCCAACGATTTCAAG
ACGTTTGAGCGCGTCCTCGTCCAGGGATACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail