Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|959
Gene name
LocationContig_12:46595..48410
Strand-
Gene length (bp)1815
Transcript length (bp)1815
Coding sequence length (bp)1815
Protein length (aa) 605

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.6E-09 67 491

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P39980|SIT1_YEAST Siderophore iron transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIT1 PE=3 SV=1 14 598 1.0E-165
sp|P38731|ARN1_YEAST Siderophore iron transporter ARN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN1 PE=1 SV=1 14 597 4.0E-140
sp|P38724|ARN2_YEAST Siderophore iron transporter ARN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN2 PE=3 SV=2 12 596 4.0E-128
sp|P36173|GEX2_YEAST Glutathione exchanger 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX2 PE=1 SV=1 52 586 4.0E-113
sp|P25596|GEX1_YEAST Glutathione exchanger 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX1 PE=1 SV=4 52 586 7.0E-113
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P39980|SIT1_YEAST Siderophore iron transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIT1 PE=3 SV=1 14 598 1.0E-165
sp|P38731|ARN1_YEAST Siderophore iron transporter ARN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN1 PE=1 SV=1 14 597 4.0E-140
sp|P38724|ARN2_YEAST Siderophore iron transporter ARN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN2 PE=3 SV=2 12 596 4.0E-128
sp|P36173|GEX2_YEAST Glutathione exchanger 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX2 PE=1 SV=1 52 586 4.0E-113
sp|P25596|GEX1_YEAST Glutathione exchanger 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX1 PE=1 SV=4 52 586 7.0E-113
sp|Q870L3|MIRC_EMENI Siderophore iron transporter mirC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirC PE=3 SV=1 7 593 1.0E-88
sp|Q08299|ENB1_YEAST Siderophore iron transporter ENB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENB1 PE=1 SV=1 40 604 1.0E-88
sp|O74395|STR1_SCHPO Siderophore iron transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str1 PE=1 SV=1 10 592 7.0E-74
sp|Q8X1Z7|MIRA_EMENI Siderophore iron transporter mirA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirA PE=3 SV=1 45 599 1.0E-68
sp|Q870L2|MIRB_EMENI Siderophore iron transporter mirB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirB PE=3 SV=1 2 580 8.0E-64
sp|O94607|STR2_SCHPO Siderophore iron transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str2 PE=1 SV=1 4 590 3.0E-53
sp|Q92341|STR3_SCHPO Siderophore iron transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str3 PE=1 SV=1 8 599 4.0E-48
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 66 598 9.0E-08
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 58 328 4.0E-07
sp|P33335|SGE1_YEAST Protein SGE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGE1 PE=1 SV=1 120 511 3.0E-06
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 62 537 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

Domain # Start End Length
1 64 86 22
2 90 112 22
3 125 144 19
4 154 176 22
5 188 205 17
6 220 242 22
7 272 294 22
8 304 326 22
9 347 369 22
10 384 406 22
11 411 433 22
12 443 460 17
13 481 503 22
14 551 573 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|959
MSTSPAFRPDASAEKDVAPGAGARPVDDDGPGPGSAADAVKDIKSPGVARVEALSAAITPVDRVCIFLSVFLVAY
AYGLDGTLRYAYQPVATASFGAHSLQATVNVIRSVIAAAAQPTAAKIADVFGRVELICVSVFFYVLGTVVEASAT
NVDTFAGGSVIYQVGYTMILLLVEVIIADITSTRSRLVFSYVPALPFIINTWVSGNISESVLRVTTWHWGVGMWC
IIYPVCAMPLILSLWMVSRRAKKQGRLADYRSSFQLLGLRTFSLELFWLLDVIGLIFMIALFALILVPLTIAGGF
QNQWRSAHVIAPLVVGVVCIPVFVLWELRAPHPLVPFSLMKDRSVWAPIGIAIFLNFAYTMQSDFLFTVLQVAFD
FSVAAATRITSLYAFTSVIVGPIIGLTVYYVRRLKVFVVAGTALYMVAFGLLIHYRGAPSGSSRAGVIGAQVLLG
IAGGMFPYTAQASLQVGLKHENLAVMTGIYLAVYNIGSALGNTVSGAMWTQLLPAKLDETLAGVNSTLAAVAYAN
PFKGVVDVYPVGTPERTAVVEAYQSVQRVLCIAGVCLCVPLIFFAIMLRNPMLTNKQTLAEGSSSSDSEGEDHTI
ISRS*
Coding >Hirsu2|959
ATGTCGACGTCGCCGGCCTTCCGCCCGGACGCGTCCGCCGAAAAGGACGTCGCCCCCGGCGCCGGCGCCCGTCCC
GTTGATGACGACGGCCCCGGCCCCGGCTCGGCTGCCGATGCCGTCAAGGACATCAAGTCGCCCGGCGTCGCCCGC
GTCGAGGCTCTGTCGGCCGCCATCACGCCCGTCGACCGCGTCTGCATCTTCCTCTCCGTCTTCCTCGTCGCCTAC
GCCTACGGCCTCGACGGCACGCTCCGCTACGCCTACCAGCCCGTCGCCACGGCCTCTTTCGGCGCCCACTCGCTC
CAGGCCACCGTCAATGTCATCCGCTCCGTGATCGCCGCTGCCGCCCAGCCGACGGCGGCCAAGATCGCCGACGTC
TTCGGCCGCGTCGAGCTCATCTGCGTCTCCGTCTTCTTCTACGTCCTCGGCACCGTCGTCGAGGCCTCCGCCACC
AACGTCGATACCTTTGCCGGCGGCAGCGTTATCTACCAGGTCGGCTATACTATGATACTCCTACTAGTCGAGGTC
ATCATCGCCGATATTACCTCAACCCGCTCCCGTCTCGTATTCAGTTACGTGCCCGCCCTACCTTTTATTATAAAC
ACCTGGGTCAGCGGCAACATCTCGGAGTCGGTCCTCCGCGTCACTACCTGGCACTGGGGCGTCGGCATGTGGTGC
ATTATCTACCCAGTCTGCGCCATGCCCTTGATATTGAGCCTCTGGATGGTCTCCCGTCGCGCCAAGAAACAGGGC
CGTCTCGCCGACTACCGCTCCTCCTTCCAGCTCCTTGGCCTCCGCACTTTCTCCCTCGAGCTCTTCTGGCTCCTC
GATGTCATCGGCCTCATATTCATGATCGCCCTCTTCGCCCTCATCCTCGTGCCCCTGACCATCGCCGGCGGCTTC
CAAAACCAGTGGAGATCGGCCCATGTTATTGCTCCGCTCGTCGTTGGCGTCGTCTGCATCCCCGTCTTCGTCCTC
TGGGAGCTCAGGGCCCCCCATCCGCTGGTACCCTTCTCTCTGATGAAGGACCGGTCCGTGTGGGCGCCCATCGGA
ATCGCCATTTTCCTCAACTTCGCCTACACCATGCAGTCCGACTTCCTCTTCACCGTTCTACAGGTCGCCTTTGAC
TTCTCCGTCGCCGCCGCCACCCGTATCACCTCGCTCTATGCCTTTACCAGCGTCATCGTCGGACCCATCATTGGC
CTGACCGTCTACTACGTGCGCCGGCTCAAGGTCTTCGTCGTCGCCGGAACGGCCCTCTACATGGTCGCCTTTGGC
CTTCTCATCCACTACCGCGGCGCGCCCTCGGGCAGCAGCCGCGCCGGCGTTATCGGGGCGCAGGTGCTCCTGGGT
ATCGCAGGGGGCATGTTTCCCTACACCGCCCAGGCATCGCTCCAGGTCGGGCTCAAACACGAGAACCTGGCTGTC
ATGACGGGAATTTATCTGGCCGTCTACAACATCGGCTCTGCCCTGGGAAACACCGTTTCCGGTGCCATGTGGACG
CAACTGCTACCCGCCAAGCTGGACGAGACGCTGGCCGGCGTCAACTCGACCCTGGCCGCCGTCGCCTACGCTAAC
CCCTTTAAAGGCGTCGTCGACGTCTATCCCGTGGGCACGCCCGAGCGGACGGCCGTCGTGGAGGCGTACCAGTCG
GTCCAGCGCGTCCTCTGCATCGCCGGCGTCTGCCTCTGCGTCCCGCTCATCTTCTTCGCCATCATGCTTCGCAAC
CCCATGCTCACGAACAAGCAGACGCTGGCGGAAGGAAGCTCCTCTTCCGACTCCGAAGGCGAGGATCACACGATA
ATAAGTCGCTCTTAG
Transcript >Hirsu2|959
ATGTCGACGTCGCCGGCCTTCCGCCCGGACGCGTCCGCCGAAAAGGACGTCGCCCCCGGCGCCGGCGCCCGTCCC
GTTGATGACGACGGCCCCGGCCCCGGCTCGGCTGCCGATGCCGTCAAGGACATCAAGTCGCCCGGCGTCGCCCGC
GTCGAGGCTCTGTCGGCCGCCATCACGCCCGTCGACCGCGTCTGCATCTTCCTCTCCGTCTTCCTCGTCGCCTAC
GCCTACGGCCTCGACGGCACGCTCCGCTACGCCTACCAGCCCGTCGCCACGGCCTCTTTCGGCGCCCACTCGCTC
CAGGCCACCGTCAATGTCATCCGCTCCGTGATCGCCGCTGCCGCCCAGCCGACGGCGGCCAAGATCGCCGACGTC
TTCGGCCGCGTCGAGCTCATCTGCGTCTCCGTCTTCTTCTACGTCCTCGGCACCGTCGTCGAGGCCTCCGCCACC
AACGTCGATACCTTTGCCGGCGGCAGCGTTATCTACCAGGTCGGCTATACTATGATACTCCTACTAGTCGAGGTC
ATCATCGCCGATATTACCTCAACCCGCTCCCGTCTCGTATTCAGTTACGTGCCCGCCCTACCTTTTATTATAAAC
ACCTGGGTCAGCGGCAACATCTCGGAGTCGGTCCTCCGCGTCACTACCTGGCACTGGGGCGTCGGCATGTGGTGC
ATTATCTACCCAGTCTGCGCCATGCCCTTGATATTGAGCCTCTGGATGGTCTCCCGTCGCGCCAAGAAACAGGGC
CGTCTCGCCGACTACCGCTCCTCCTTCCAGCTCCTTGGCCTCCGCACTTTCTCCCTCGAGCTCTTCTGGCTCCTC
GATGTCATCGGCCTCATATTCATGATCGCCCTCTTCGCCCTCATCCTCGTGCCCCTGACCATCGCCGGCGGCTTC
CAAAACCAGTGGAGATCGGCCCATGTTATTGCTCCGCTCGTCGTTGGCGTCGTCTGCATCCCCGTCTTCGTCCTC
TGGGAGCTCAGGGCCCCCCATCCGCTGGTACCCTTCTCTCTGATGAAGGACCGGTCCGTGTGGGCGCCCATCGGA
ATCGCCATTTTCCTCAACTTCGCCTACACCATGCAGTCCGACTTCCTCTTCACCGTTCTACAGGTCGCCTTTGAC
TTCTCCGTCGCCGCCGCCACCCGTATCACCTCGCTCTATGCCTTTACCAGCGTCATCGTCGGACCCATCATTGGC
CTGACCGTCTACTACGTGCGCCGGCTCAAGGTCTTCGTCGTCGCCGGAACGGCCCTCTACATGGTCGCCTTTGGC
CTTCTCATCCACTACCGCGGCGCGCCCTCGGGCAGCAGCCGCGCCGGCGTTATCGGGGCGCAGGTGCTCCTGGGT
ATCGCAGGGGGCATGTTTCCCTACACCGCCCAGGCATCGCTCCAGGTCGGGCTCAAACACGAGAACCTGGCTGTC
ATGACGGGAATTTATCTGGCCGTCTACAACATCGGCTCTGCCCTGGGAAACACCGTTTCCGGTGCCATGTGGACG
CAACTGCTACCCGCCAAGCTGGACGAGACGCTGGCCGGCGTCAACTCGACCCTGGCCGCCGTCGCCTACGCTAAC
CCCTTTAAAGGCGTCGTCGACGTCTATCCCGTGGGCACGCCCGAGCGGACGGCCGTCGTGGAGGCGTACCAGTCG
GTCCAGCGCGTCCTCTGCATCGCCGGCGTCTGCCTCTGCGTCCCGCTCATCTTCTTCGCCATCATGCTTCGCAAC
CCCATGCTCACGAACAAGCAGACGCTGGCGGAAGGAAGCTCCTCTTCCGACTCCGAAGGCGAGGATCACACGATA
ATAAGTCGCTCTTAG
Gene >Hirsu2|959
ATGTCGACGTCGCCGGCCTTCCGCCCGGACGCGTCCGCCGAAAAGGACGTCGCCCCCGGCGCCGGCGCCCGTCCC
GTTGATGACGACGGCCCCGGCCCCGGCTCGGCTGCCGATGCCGTCAAGGACATCAAGTCGCCCGGCGTCGCCCGC
GTCGAGGCTCTGTCGGCCGCCATCACGCCCGTCGACCGCGTCTGCATCTTCCTCTCCGTCTTCCTCGTCGCCTAC
GCCTACGGCCTCGACGGCACGCTCCGCTACGCCTACCAGCCCGTCGCCACGGCCTCTTTCGGCGCCCACTCGCTC
CAGGCCACCGTCAATGTCATCCGCTCCGTGATCGCCGCTGCCGCCCAGCCGACGGCGGCCAAGATCGCCGACGTC
TTCGGCCGCGTCGAGCTCATCTGCGTCTCCGTCTTCTTCTACGTCCTCGGCACCGTCGTCGAGGCCTCCGCCACC
AACGTCGATACCTTTGCCGGCGGCAGCGTTATCTACCAGGTCGGCTATACTATGATACTCCTACTAGTCGAGGTC
ATCATCGCCGATATTACCTCAACCCGCTCCCGTCTCGTATTCAGTTACGTGCCCGCCCTACCTTTTATTATAAAC
ACCTGGGTCAGCGGCAACATCTCGGAGTCGGTCCTCCGCGTCACTACCTGGCACTGGGGCGTCGGCATGTGGTGC
ATTATCTACCCAGTCTGCGCCATGCCCTTGATATTGAGCCTCTGGATGGTCTCCCGTCGCGCCAAGAAACAGGGC
CGTCTCGCCGACTACCGCTCCTCCTTCCAGCTCCTTGGCCTCCGCACTTTCTCCCTCGAGCTCTTCTGGCTCCTC
GATGTCATCGGCCTCATATTCATGATCGCCCTCTTCGCCCTCATCCTCGTGCCCCTGACCATCGCCGGCGGCTTC
CAAAACCAGTGGAGATCGGCCCATGTTATTGCTCCGCTCGTCGTTGGCGTCGTCTGCATCCCCGTCTTCGTCCTC
TGGGAGCTCAGGGCCCCCCATCCGCTGGTACCCTTCTCTCTGATGAAGGACCGGTCCGTGTGGGCGCCCATCGGA
ATCGCCATTTTCCTCAACTTCGCCTACACCATGCAGTCCGACTTCCTCTTCACCGTTCTACAGGTCGCCTTTGAC
TTCTCCGTCGCCGCCGCCACCCGTATCACCTCGCTCTATGCCTTTACCAGCGTCATCGTCGGACCCATCATTGGC
CTGACCGTCTACTACGTGCGCCGGCTCAAGGTCTTCGTCGTCGCCGGAACGGCCCTCTACATGGTCGCCTTTGGC
CTTCTCATCCACTACCGCGGCGCGCCCTCGGGCAGCAGCCGCGCCGGCGTTATCGGGGCGCAGGTGCTCCTGGGT
ATCGCAGGGGGCATGTTTCCCTACACCGCCCAGGCATCGCTCCAGGTCGGGCTCAAACACGAGAACCTGGCTGTC
ATGACGGGAATTTATCTGGCCGTCTACAACATCGGCTCTGCCCTGGGAAACACCGTTTCCGGTGCCATGTGGACG
CAACTGCTACCCGCCAAGCTGGACGAGACGCTGGCCGGCGTCAACTCGACCCTGGCCGCCGTCGCCTACGCTAAC
CCCTTTAAAGGCGTCGTCGACGTCTATCCCGTGGGCACGCCCGAGCGGACGGCCGTCGTGGAGGCGTACCAGTCG
GTCCAGCGCGTCCTCTGCATCGCCGGCGTCTGCCTCTGCGTCCCGCTCATCTTCTTCGCCATCATGCTTCGCAAC
CCCATGCTCACGAACAAGCAGACGCTGGCGGAAGGAAGCTCCTCTTCCGACTCCGAAGGCGAGGATCACACGATA
ATAAGTCGCTCTTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail