Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9588
Gene name
LocationContig_705:10694..12970
Strand+
Gene length (bp)2276
Transcript length (bp)2130
Coding sequence length (bp)2130
Protein length (aa) 710

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02383 Syja_N SacI homology domain 4.5E-88 66 411

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32368|SAC1_YEAST Phosphoinositide phosphatase SAC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAC1 PE=1 SV=1 43 659 2.0E-141
sp|O60162|YG23_SCHPO Uncharacterized protein C19F5.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC19F5.03 PE=1 SV=1 35 659 2.0E-130
sp|Q9W0I6|SAC1_DROME Phosphatidylinositide phosphatase SAC1 OS=Drosophila melanogaster GN=Sac1 PE=2 SV=1 11 661 4.0E-105
sp|A6QL88|SAC1_BOVIN Phosphatidylinositide phosphatase SAC1 OS=Bos taurus GN=SACM1L PE=2 SV=1 11 659 2.0E-102
sp|Q9ES21|SAC1_RAT Phosphatidylinositide phosphatase SAC1 OS=Rattus norvegicus GN=Sacm1l PE=1 SV=1 11 659 4.0E-102
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32368|SAC1_YEAST Phosphoinositide phosphatase SAC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAC1 PE=1 SV=1 43 659 2.0E-141
sp|O60162|YG23_SCHPO Uncharacterized protein C19F5.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC19F5.03 PE=1 SV=1 35 659 2.0E-130
sp|Q9W0I6|SAC1_DROME Phosphatidylinositide phosphatase SAC1 OS=Drosophila melanogaster GN=Sac1 PE=2 SV=1 11 661 4.0E-105
sp|A6QL88|SAC1_BOVIN Phosphatidylinositide phosphatase SAC1 OS=Bos taurus GN=SACM1L PE=2 SV=1 11 659 2.0E-102
sp|Q9ES21|SAC1_RAT Phosphatidylinositide phosphatase SAC1 OS=Rattus norvegicus GN=Sacm1l PE=1 SV=1 11 659 4.0E-102
sp|Q9NTJ5|SAC1_HUMAN Phosphatidylinositide phosphatase SAC1 OS=Homo sapiens GN=SACM1L PE=1 SV=2 11 659 1.0E-101
sp|Q5R921|SAC1_PONAB Phosphatidylinositide phosphatase SAC1 OS=Pongo abelii GN=SACM1L PE=2 SV=1 11 659 1.0E-101
sp|Q9EP69|SAC1_MOUSE Phosphatidylinositide phosphatase SAC1 OS=Mus musculus GN=Sacm1l PE=1 SV=1 11 659 3.0E-101
sp|Q6GM29|SAC1_XENLA Phosphatidylinositide phosphatase SAC1 OS=Xenopus laevis GN=sacm1l PE=2 SV=1 9 659 6.0E-99
sp|A1L244|SAC1A_DANRE Phosphatidylinositide phosphatase SAC1-A OS=Danio rerio GN=sacm1la PE=2 SV=1 11 659 4.0E-98
sp|A4VCH0|SAC1B_DANRE Phosphatidylinositide phosphatase SAC1-B OS=Danio rerio GN=sacm1lb PE=2 SV=2 11 659 4.0E-98
sp|O14127|YF51_SCHPO Uncharacterized protein C3C7.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3C7.01c PE=3 SV=2 67 669 1.0E-81
sp|Q7X911|SAC6_ARATH Phosphoinositide phosphatase SAC6 OS=Arabidopsis thaliana GN=SAC6 PE=2 SV=1 21 662 2.0E-80
sp|Q9C5G5|SAC7_ARATH Phosphoinositide phosphatase SAC7 OS=Arabidopsis thaliana GN=SAC7 PE=2 SV=1 21 662 6.0E-80
sp|Q55AW9|SAC1_DICDI Phosphatidylinositide phosphatase SAC1 OS=Dictyostelium discoideum GN=sac1 PE=3 SV=1 13 572 1.0E-79
sp|Q96328|SAC8_ARATH Phosphoinositide phosphatase SAC8 OS=Arabidopsis thaliana GN=SAC8 PE=2 SV=1 21 659 2.0E-77
sp|A8E7C5|SAC2_DANRE Phosphatidylinositide phosphatase SAC2 OS=Danio rerio GN=inpp5f PE=3 SV=1 64 574 2.0E-69
sp|Q9Y2H2|SAC2_HUMAN Phosphatidylinositide phosphatase SAC2 OS=Homo sapiens GN=INPP5F PE=1 SV=3 64 574 6.0E-65
sp|Q8CDA1|SAC2_MOUSE Phosphatidylinositide phosphatase SAC2 OS=Mus musculus GN=Inpp5f PE=1 SV=1 64 574 5.0E-63
sp|O43426|SYNJ1_HUMAN Synaptojanin-1 OS=Homo sapiens GN=SYNJ1 PE=1 SV=2 59 573 5.0E-50
sp|Q8CHC4|SYNJ1_MOUSE Synaptojanin-1 OS=Mus musculus GN=Synj1 PE=1 SV=3 59 573 9.0E-50
sp|Q62910|SYNJ1_RAT Synaptojanin-1 OS=Rattus norvegicus GN=Synj1 PE=1 SV=3 59 573 2.0E-49
sp|O18964|SYNJ1_BOVIN Synaptojanin-1 (Fragment) OS=Bos taurus GN=SYNJ1 PE=1 SV=2 59 573 5.0E-48
sp|P50942|INP52_YEAST Polyphosphatidylinositol phosphatase INP52 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INP52 PE=1 SV=1 124 574 5.0E-47
sp|O43001|SYJ1_SCHPO Inositol-1,4,5-trisphosphate 5-phosphatase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=syj1 PE=1 SV=1 60 574 3.0E-46
sp|O15056|SYNJ2_HUMAN Synaptojanin-2 OS=Homo sapiens GN=SYNJ2 PE=1 SV=3 60 573 6.0E-42
sp|Q9D2G5|SYNJ2_MOUSE Synaptojanin-2 OS=Mus musculus GN=Synj2 PE=1 SV=2 59 573 8.0E-42
sp|Q12271|INP53_YEAST Polyphosphatidylinositol phosphatase INP53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INP53 PE=1 SV=1 124 574 2.0E-41
sp|Q94A27|SAC2_ARATH Phosphoinositide phosphatase SAC2 OS=Arabidopsis thaliana GN=SAC2 PE=2 SV=1 52 578 1.0E-40
sp|O55207|SYNJ2_RAT Synaptojanin-2 OS=Rattus norvegicus GN=Synj2 PE=1 SV=2 66 573 3.0E-40
sp|Q91WF7|FIG4_MOUSE Polyphosphoinositide phosphatase OS=Mus musculus GN=Fig4 PE=1 SV=1 60 578 6.0E-39
sp|Q92562|FIG4_HUMAN Polyphosphoinositide phosphatase OS=Homo sapiens GN=FIG4 PE=1 SV=1 60 578 8.0E-39
sp|Q7XZU1|SAC4_ARATH Phosphoinositide phosphatase SAC4 OS=Arabidopsis thaliana GN=SAC4 PE=2 SV=1 52 578 1.0E-36
sp|P42837|FIG4_YEAST Polyphosphoinositide phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FIG4 PE=1 SV=1 66 576 2.0E-35
sp|Q7Z9H9|FIG4_SCHPO Polyphosphoinositide phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1093.03 PE=3 SV=3 61 593 7.0E-35
sp|Q7XZU2|SAC3_ARATH Phosphoinositide phosphatase SAC3 OS=Arabidopsis thaliana GN=SAC3 PE=2 SV=1 52 578 9.0E-35
sp|Q8RW97|SAC5_ARATH Phosphoinositide phosphatase SAC5 OS=Arabidopsis thaliana GN=SAC5 PE=2 SV=1 61 578 9.0E-34
sp|Q7XZU3|SAC1_ARATH Phosphoinositide phosphatase SAC1 OS=Arabidopsis thaliana GN=SAC1 PE=1 SV=1 61 578 1.0E-33
sp|Q9USQ6|SYJ2_SCHPO Inositol-1,4,5-trisphosphate 5-phosphatase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=syj2 PE=2 SV=1 124 583 1.0E-26
sp|Q7XZU0|SAC9_ARATH Probable phosphoinositide phosphatase SAC9 OS=Arabidopsis thaliana GN=SAC9 PE=1 SV=1 93 477 2.0E-11
sp|P40559|INP51_YEAST Phosphatidylinositol 4,5-bisphosphate 5-phosphatase INP51 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INP51 PE=1 SV=1 66 515 2.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0042578 phosphoric ester hydrolase activity Yes
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

Domain # Start End Length
1 595 617 22
2 630 652 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9588
MAPLAAPKLPYRDVNLRVTHDAYIFASPSSPDAPALLIDRPTADIHLADPGLHSAKRASRVSSVAGILGVVQLRL
DKYVVIISKAQPVGRLKGHMVYKVVAAEILPMRERQIHDPDEDTFINLLQTFLRRGPMYFSYSIDLTNSFQRQSQ
SDSSSPLWMRADDRFFFNKYLQTDLIDFRRQGSRTQPGPQPAIDPYILPCVFGMLDIRQTKFNNTPLTLALISRR
SRYRGGTRYFTRGVDDDGHVANYNETEQIVILNDSSTGLGGYAGSSDMQSGKFGTTAAQETQVMSYVQTRGSVPT
YWSEINSLRYVPKLQVRATDAALAAAQKHFDEQIRLYGDNYLINLVNQKGREARVKESYERMVETLVTGPREGRE
ADRLTEEKFTTIQPGSKRQEFDRLHYIYFDYHSETKGTQMYKAYKLVEKLREALASQGYFRGVDTPANVDGRVDV
RSLQTSVMRVNCMDCLDRTNVVQSMFGRHVLDRILGDLGLMARGASFRDVDPAFEHVFRNVWADNADVVSTSYAG
TGAMKTDVTRTGQRTKVGALQDARIGLTRYFLNNFRDGPRQDSYDLFLGAYRPGTTPVGASLVFADRRPLLIQSI
PYLLAFSVFIVLVGLLTRRDPGARVLPMRLFVAFWSVVAAWCFHFIWTHGMLYVNWPRLNPRPFAVDGFGEHYSK
ARKDAIIGSFVARHERGLSAVRYLNAEEGKKRIE*
Coding >Hirsu2|9588
ATGGCGCCCCTCGCTGCGCCCAAGCTGCCTTATCGAGATGTCAACCTGCGCGTCACCCACGACGCCTACATCTTC
GCCTCGCCCTCGTCGCCCGATGCGCCGGCCTTGCTCATTGACCGTCCCACCGCCGACATTCACCTGGCCGACCCG
GGTCTGCACTCGGCAAAACGCGCAAGTCGCGTCTCGAGCGTCGCTGGCATCCTCGGCGTCGTTCAGCTCAGGCTA
GACAAGTATGTTGTCATCATCAGCAAGGCCCAGCCCGTGGGCCGTCTTAAGGGCCACATGGTCTACAAGGTCGTC
GCCGCCGAGATCCTCCCCATGCGCGAGCGCCAAATCCACGACCCCGATGAGGACACCTTCATCAACCTCCTCCAG
ACCTTCCTGCGCCGGGGCCCCATGTACTTCTCCTACTCCATCGACCTCACAAACTCCTTCCAGCGCCAGTCGCAG
TCCGACTCCTCCAGCCCGCTCTGGATGAGGGCCGACGACCGCTTCTTCTTCAACAAGTACCTGCAGACGGATCTC
ATCGACTTCCGCAGACAGGGTTCCCGAACCCAGCCCGGCCCCCAACCGGCCATCGACCCTTATATCCTGCCATGC
GTCTTCGGCATGTTAGACATCAGACAAACCAAGTTCAACAACACCCCCCTCACCCTCGCCTTGATCTCGCGAAGG
TCCCGCTACCGCGGCGGCACCCGTTACTTTACTCGTGGCGTCGACGACGACGGCCACGTGGCAAACTACAACGAG
ACAGAGCAGATCGTCATCCTCAACGACAGCAGCACCGGCCTGGGTGGCTATGCCGGCAGCTCCGACATGCAGAGC
GGCAAGTTTGGCACTACGGCCGCCCAGGAGACGCAGGTCATGTCGTACGTCCAGACTCGAGGGAGCGTGCCGACC
TATTGGTCCGAGATCAACAGCCTGCGCTACGTCCCCAAGCTCCAGGTGCGCGCCACCGACGCGGCTCTCGCCGCT
GCCCAGAAGCACTTTGACGAGCAAATCCGGCTCTACGGCGACAACTACCTCATCAACCTCGTCAACCAGAAGGGG
CGCGAGGCCAGGGTCAAGGAGTCGTACGAGCGAATGGTCGAGACGCTCGTGACGGGACCCAGAGAGGGCCGCGAG
GCCGACAGACTGACCGAGGAGAAGTTCACGACGATCCAGCCCGGATCCAAGAGGCAAGAGTTCGACCGGCTGCAC
TACATCTACTTTGACTACCACAGCGAGACGAAGGGCACGCAGATGTACAAGGCGTACAAGCTCGTCGAGAAGCTG
CGAGAAGCCCTCGCCAGCCAGGGCTACTTCCGCGGCGTCGACACGCCGGCCAACGTGGACGGGCGCGTCGACGTG
CGCAGCCTCCAGACGAGCGTGATGCGCGTCAACTGCATGGACTGCCTGGACCGCACCAACGTGGTGCAGAGCATG
TTCGGGCGGCACGTGCTGGACCGCATCCTGGGGGACCTCGGGCTGATGGCGCGCGGCGCCAGCTTCCGCGACGTG
GACCCGGCCTTTGAGCACGTCTTCCGCAACGTGTGGGCGGACAACGCGGACGTGGTGTCGACGTCGTACGCCGGC
ACGGGCGCCATGAAGACGGACGTGACGCGGACGGGCCAGCGCACCAAGGTCGGGGCCCTGCAGGACGCGCGCATC
GGCCTGACGCGCTACTTCCTCAACAACTTCCGGGACGGGCCGCGGCAGGACTCGTACGACCTGTTCCTGGGCGCG
TACCGGCCGGGCACGACGCCCGTCGGCGCCAGCCTCGTCTTCGCCGACCGGCGGCCGCTGCTGATCCAGTCGATC
CCGTACCTGCTGGCCTTTAGCGTCTTCATCGTGCTCGTCGGCCTCTTGACCAGGCGCGACCCGGGCGCCCGCGTC
CTGCCCATGCGCCTCTTCGTCGCCTTCTGGAGCGTCGTCGCCGCCTGGTGCTTCCACTTTATCTGGACGCACGGC
ATGCTCTACGTCAACTGGCCGCGCCTCAACCCGCGGCCGTTCGCGGTGGACGGCTTCGGCGAGCACTATTCCAAA
GCGCGCAAGGACGCCATCATCGGCTCCTTCGTCGCCCGGCACGAGAGGGGGCTCAGCGCCGTGCGGTACCTGAAT
GCCGAGGAGGGCAAGAAGAGGATCGAGTAA
Transcript >Hirsu2|9588
ATGGCGCCCCTCGCTGCGCCCAAGCTGCCTTATCGAGATGTCAACCTGCGCGTCACCCACGACGCCTACATCTTC
GCCTCGCCCTCGTCGCCCGATGCGCCGGCCTTGCTCATTGACCGTCCCACCGCCGACATTCACCTGGCCGACCCG
GGTCTGCACTCGGCAAAACGCGCAAGTCGCGTCTCGAGCGTCGCTGGCATCCTCGGCGTCGTTCAGCTCAGGCTA
GACAAGTATGTTGTCATCATCAGCAAGGCCCAGCCCGTGGGCCGTCTTAAGGGCCACATGGTCTACAAGGTCGTC
GCCGCCGAGATCCTCCCCATGCGCGAGCGCCAAATCCACGACCCCGATGAGGACACCTTCATCAACCTCCTCCAG
ACCTTCCTGCGCCGGGGCCCCATGTACTTCTCCTACTCCATCGACCTCACAAACTCCTTCCAGCGCCAGTCGCAG
TCCGACTCCTCCAGCCCGCTCTGGATGAGGGCCGACGACCGCTTCTTCTTCAACAAGTACCTGCAGACGGATCTC
ATCGACTTCCGCAGACAGGGTTCCCGAACCCAGCCCGGCCCCCAACCGGCCATCGACCCTTATATCCTGCCATGC
GTCTTCGGCATGTTAGACATCAGACAAACCAAGTTCAACAACACCCCCCTCACCCTCGCCTTGATCTCGCGAAGG
TCCCGCTACCGCGGCGGCACCCGTTACTTTACTCGTGGCGTCGACGACGACGGCCACGTGGCAAACTACAACGAG
ACAGAGCAGATCGTCATCCTCAACGACAGCAGCACCGGCCTGGGTGGCTATGCCGGCAGCTCCGACATGCAGAGC
GGCAAGTTTGGCACTACGGCCGCCCAGGAGACGCAGGTCATGTCGTACGTCCAGACTCGAGGGAGCGTGCCGACC
TATTGGTCCGAGATCAACAGCCTGCGCTACGTCCCCAAGCTCCAGGTGCGCGCCACCGACGCGGCTCTCGCCGCT
GCCCAGAAGCACTTTGACGAGCAAATCCGGCTCTACGGCGACAACTACCTCATCAACCTCGTCAACCAGAAGGGG
CGCGAGGCCAGGGTCAAGGAGTCGTACGAGCGAATGGTCGAGACGCTCGTGACGGGACCCAGAGAGGGCCGCGAG
GCCGACAGACTGACCGAGGAGAAGTTCACGACGATCCAGCCCGGATCCAAGAGGCAAGAGTTCGACCGGCTGCAC
TACATCTACTTTGACTACCACAGCGAGACGAAGGGCACGCAGATGTACAAGGCGTACAAGCTCGTCGAGAAGCTG
CGAGAAGCCCTCGCCAGCCAGGGCTACTTCCGCGGCGTCGACACGCCGGCCAACGTGGACGGGCGCGTCGACGTG
CGCAGCCTCCAGACGAGCGTGATGCGCGTCAACTGCATGGACTGCCTGGACCGCACCAACGTGGTGCAGAGCATG
TTCGGGCGGCACGTGCTGGACCGCATCCTGGGGGACCTCGGGCTGATGGCGCGCGGCGCCAGCTTCCGCGACGTG
GACCCGGCCTTTGAGCACGTCTTCCGCAACGTGTGGGCGGACAACGCGGACGTGGTGTCGACGTCGTACGCCGGC
ACGGGCGCCATGAAGACGGACGTGACGCGGACGGGCCAGCGCACCAAGGTCGGGGCCCTGCAGGACGCGCGCATC
GGCCTGACGCGCTACTTCCTCAACAACTTCCGGGACGGGCCGCGGCAGGACTCGTACGACCTGTTCCTGGGCGCG
TACCGGCCGGGCACGACGCCCGTCGGCGCCAGCCTCGTCTTCGCCGACCGGCGGCCGCTGCTGATCCAGTCGATC
CCGTACCTGCTGGCCTTTAGCGTCTTCATCGTGCTCGTCGGCCTCTTGACCAGGCGCGACCCGGGCGCCCGCGTC
CTGCCCATGCGCCTCTTCGTCGCCTTCTGGAGCGTCGTCGCCGCCTGGTGCTTCCACTTTATCTGGACGCACGGC
ATGCTCTACGTCAACTGGCCGCGCCTCAACCCGCGGCCGTTCGCGGTGGACGGCTTCGGCGAGCACTATTCCAAA
GCGCGCAAGGACGCCATCATCGGCTCCTTCGTCGCCCGGCACGAGAGGGGGCTCAGCGCCGTGCGGTACCTGAAT
GCCGAGGAGGGCAAGAAGAGGATCGAGTAA
Gene >Hirsu2|9588
ATGGCGCCCCTCGCTGCGCCCAAGCTGCCTTATCGAGATGTCAACCTGCGCGTCACCCACGACGCCTACATCTTC
GCCTCGCCCTCGTCGCCCGATGCGCCGGCCTTGCTCATTGACCGTCCCACCGCCGACATTCACCTGGCCGACCCG
GGTCTGCACTCGGCAAAACGCGCAAGTCGCGTCTCGAGCGTCGCTGGCATCCTCGGCGTCGTTCAGCTCAGGCTA
GGTTCGGCCTTGAGGTGCCCCCCCCCCCACGAAAGAACGTGTCGCTGATACTCCGAGCGCGCAGACAAGTATGTT
GTCATCATCAGCAAGGCCCAGCCCGTGGGCCGTCTTAAGGGCCACATGGTCTACAAGGTCGTCGCCGCCGAGATC
CTCCCCATGCGCGAGCGCCAAATCCACGACCCCGATGAGGACACCTTCATCAACCTCCTCCAGACCTTCCTGCGC
CGGGGCCCCATGTACTTCTCCTACTCCATCGACCTCACAAACTCCTTCCAGCGCCAGTCGCAGTCCGACTCCTCC
AGCCCGCTCTGGATGAGGGCCGACGACCGCTTCTTCTTCAACAAGTACCTGCAGACGGATCTCATCGACTTCCGC
AGACAGGGTTCCCGAACCCAGCCCGGCCCCCAACCGGCCATCGACCCTTATATCCTGCCATGCGTCTTCGGCATG
TTAGACATCAGACAAACCAAGTTCAACAACACCCCCCTCACCCTCGCCTTGATCTCGCGAAGGTCCCGCTACCGC
GGCGGCACCCGTTACTTTACTCGTGGCGTCGACGACGACGGCCACGTGGCAAACTACAACGAGACAGAGCAGATC
GTCATCCTCAACGACAGCAGCACCGGCCTGGGTGGCTATGCCGGCAGCTCCGACATGCAGAGCGGCAAGTTTGGC
ACTACGGCCGCCCAGGAGACGCAGGTCATGTCGTACGTCCAGACTCGAGGGAGCGTGCCGACCTATTGGTCCGAG
ATCAACAGCCTGCGCTACGTCCCCAAGCTCCAGGTGCGCGCCACCGACGCGGCTCTCGCCGCTGCCCAGAAGCAC
TTTGACGAGCAAATCCGGCTCTACGGCGACAACTACCTCATCAACCTCGTCAACCAGAAGGGGCGCGAGGCCAGG
GTCAAGGAGTCGTACGAGCGAATGGTCGAGACGCTCGTGACGGGACCCAGAGAGGGCCGCGAGGCCGACAGACTG
ACCGAGGAGAAGTTCACGACGATCCAGCCCGGATCCAAGAGGCAAGAGTTCGACCGGCTGCACTACATCTACTTT
GACTACCACAGCGAGACGAAGGGCACGCAGATGTACAAGGCGTACAAGCTCGTCGAGAAGCTGCGAGAAGCCCTC
GCCAGCCAGGGCTACTTCCGCGGCGTCGACACGCCGGCCAACGTGGACGGGCGCGTCGACGTGCGCAGCCTCCAG
ACGAGCGTGATGCGCGTCAACTGCATGGACTGCCTGGACCGCACCAACGTGGTGCAGAGCATGTTCGGGCGGCAC
GTGCTGGACCGCATCCTGGGGGACCTCGGGCTGATGGCGCGCGGCGCCAGCTTCCGCGACGTGGACCCGGCCTTT
GAGCACGTCTTCCGCAACGTGTGGGCGGACAACGCGGACGTGGTGTCGACGTCGTACGCCGGCACGGGCGCCATG
AAGACGGACGTGACGCGGACGGGCCAGCGCACCAAGGTCGGGGCCCTGCAGGACGCGCGCATCGGCCTGACGCGC
TACTTCCTCAACAACTTCCGGGACGGGCCGCGGCAGGACTCGTACGACCTGTTCCTGGGCGCGTACCGGCCGGGC
ACGACGCCCGTCGGCGCCAGCCTCGTCTTCGCCGACCGGCGGCCGCTGCTGATCCAGTCGATCCCGTACCTGCTG
GCCTTTAGCGTCTTCATCGTGCTCGTCGGCCTCTTGACCAGGCGCGACCCGGGCGCCCGCGTCCTGCCCATGCGC
CTCTTCGTCGCCTTCTGGAGCGTCGTCGCCGCCTGGTGCTTCCACTTTATCTGGACGCACGGCATGCTCTACGTA
CGTATTCCCCCTCGCACCATCCTTCCCATCGGCGTGCTGCGCGACACGGCTTGCTCACTCACACACCCTCCCACC
TCTAGGTCAACTGGCCGCGCCTCAACCCGCGGCCGTTCGCGGTGGACGGCTTCGGCGAGCACTATTCCAAAGCGC
GCAAGGACGCCATCATCGGCTCCTTCGTCGCCCGGCACGAGAGGGGGCTCAGCGCCGTGCGGTACCTGAATGCCG
AGGAGGGCAAGAAGAGGATCGAGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail