Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9578
Gene name
LocationContig_703:37..430
Strand+
Gene length (bp)393
Transcript length (bp)393
Coding sequence length (bp)393
Protein length (aa) 131

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04479 RTA1 RTA1 like protein 5.2E-19 4 72

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

Domain # Start End Length
1 7 27 20
2 47 69 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9578
LRASARFRGFLAALALSTVCILWRSAFRLAELREGWRGPVLARQGLFIGFEGVLVLVAVVALNVFHPVLCAPELF
RPGAAFACCGRRRRAAADEDKASSVVDVPSVSKTHAVQEHGKELPSVSAPARPSL*
Coding >Hirsu2|9578
CTGCGCGCCTCGGCCCGCTTCCGGGGCTTCCTCGCCGCCCTCGCGCTCTCGACCGTCTGCATCCTGTGGCGCAGC
GCCTTCCGCCTCGCCGAGCTCCGCGAGGGCTGGCGCGGCCCCGTCCTCGCCCGCCAGGGCCTCTTCATCGGCTTC
GAGGGCGTCCTCGTCCTCGTTGCCGTCGTCGCCCTCAACGTCTTCCATCCCGTCCTCTGCGCACCCGAGCTCTTC
CGCCCCGGCGCCGCCTTCGCCTGCTGCGGTCGCCGCCGCCGCGCCGCCGCCGACGAGGACAAGGCCTCGTCCGTC
GTCGACGTCCCTTCCGTCAGCAAGACGCATGCTGTTCAGGAGCACGGAAAGGAGTTGCCCTCCGTCTCCGCTCCG
GCCCGTCCATCGCTCTGA
Transcript >Hirsu2|9578
CTGCGCGCCTCGGCCCGCTTCCGGGGCTTCCTCGCCGCCCTCGCGCTCTCGACCGTCTGCATCCTGTGGCGCAGC
GCCTTCCGCCTCGCCGAGCTCCGCGAGGGCTGGCGCGGCCCCGTCCTCGCCCGCCAGGGCCTCTTCATCGGCTTC
GAGGGCGTCCTCGTCCTCGTTGCCGTCGTCGCCCTCAACGTCTTCCATCCCGTCCTCTGCGCACCCGAGCTCTTC
CGCCCCGGCGCCGCCTTCGCCTGCTGCGGTCGCCGCCGCCGCGCCGCCGCCGACGAGGACAAGGCCTCGTCCGTC
GTCGACGTCCCTTCCGTCAGCAAGACGCATGCTGTTCAGGAGCACGGAAAGGAGTTGCCCTCCGTCTCCGCTCCG
GCCCGTCCATCGCTCTGA
Gene >Hirsu2|9578
CTGCGCGCCTCGGCCCGCTTCCGGGGCTTCCTCGCCGCCCTCGCGCTCTCGACCGTCTGCATCCTGTGGCGCAGC
GCCTTCCGCCTCGCCGAGCTCCGCGAGGGCTGGCGCGGCCCCGTCCTCGCCCGCCAGGGCCTCTTCATCGGCTTC
GAGGGCGTCCTCGTCCTCGTTGCCGTCGTCGCCCTCAACGTCTTCCATCCCGTCCTCTGCGCACCCGAGCTCTTC
CGCCCCGGCGCCGCCTTCGCCTGCTGCGGTCGCCGCCGCCGCGCCGCCGCCGACGAGGACAAGGCCTCGTCCGTC
GTCGACGTCCCTTCCGTCAGCAAGACGCATGCTGTTCAGGAGCACGGAAAGGAGTTGCCCTCCGTCTCCGCTCCG
GCCCGTCCATCGCTCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail