Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9577
Gene name
LocationContig_702:12588..13488
Strand+
Gene length (bp)900
Transcript length (bp)450
Coding sequence length (bp)450
Protein length (aa) 150

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04145 Ctr Ctr copper transporter family 5.2E-29 21 136

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38865|CTR2_YEAST Copper transport protein CTR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTR2 PE=1 SV=1 3 149 1.0E-31
sp|Q8K211|COPT1_MOUSE High affinity copper uptake protein 1 OS=Mus musculus GN=Slc31a1 PE=2 SV=1 7 149 2.0E-18
sp|Q9USV7|CTR6_SCHPO Copper transport protein ctr6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ctr6 PE=1 SV=1 6 133 7.0E-18
sp|O15431|COPT1_HUMAN High affinity copper uptake protein 1 OS=Homo sapiens GN=SLC31A1 PE=1 SV=1 7 149 1.0E-15
sp|Q5RAS6|COPT1_PONAB High affinity copper uptake protein 1 OS=Pongo abelii GN=SLC31A1 PE=2 SV=1 12 149 5.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38865|CTR2_YEAST Copper transport protein CTR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTR2 PE=1 SV=1 3 149 1.0E-31
sp|Q8K211|COPT1_MOUSE High affinity copper uptake protein 1 OS=Mus musculus GN=Slc31a1 PE=2 SV=1 7 149 2.0E-18
sp|Q9USV7|CTR6_SCHPO Copper transport protein ctr6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ctr6 PE=1 SV=1 6 133 7.0E-18
sp|O15431|COPT1_HUMAN High affinity copper uptake protein 1 OS=Homo sapiens GN=SLC31A1 PE=1 SV=1 7 149 1.0E-15
sp|Q5RAS6|COPT1_PONAB High affinity copper uptake protein 1 OS=Pongo abelii GN=SLC31A1 PE=2 SV=1 12 149 5.0E-15
sp|Q9JK41|COPT1_RAT High affinity copper uptake protein 1 OS=Rattus norvegicus GN=Slc31a1 PE=2 SV=1 13 149 2.0E-14
sp|O94722|CTR4_SCHPO Copper transport protein ctr4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ctr4 PE=1 SV=1 17 147 4.0E-14
sp|Q8WNR0|COPT1_PIG High affinity copper uptake protein 1 OS=Sus scrofa GN=SLC31A1 PE=2 SV=1 13 149 1.0E-13
sp|Q9P7F9|CTR5_SCHPO Copper transport protein ctr5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ctr5 PE=1 SV=1 17 147 2.0E-09
sp|Q93VM8|COPT5_ARATH Copper transporter 5 OS=Arabidopsis thaliana GN=COPT5 PE=1 SV=1 19 149 5.0E-08
sp|Q8GWP3|COPT6_ARATH Copper transporter 6 OS=Arabidopsis thaliana GN=COPT6 PE=2 SV=1 1 139 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0035434 copper ion transmembrane transport Yes
GO:0005375 copper ion transmembrane transporter activity Yes
GO:0008324 cation transmembrane transporter activity No
GO:0000041 transition metal ion transport No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0046873 metal ion transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0098655 cation transmembrane transport No
GO:0034220 ion transmembrane transport No
GO:0006812 cation transport No
GO:0051179 localization No
GO:0055085 transmembrane transport No
GO:0044425 membrane part No
GO:0098660 inorganic ion transmembrane transport No
GO:0031224 intrinsic component of membrane No
GO:0006811 ion transport No
GO:0006825 copper ion transport No
GO:0006810 transport No
GO:0022857 transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0098662 inorganic cation transmembrane transport No
GO:0046915 transition metal ion transmembrane transporter activity No
GO:0030001 metal ion transport No
GO:0003674 molecular_function No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 44 66 22
2 92 114 22
3 119 137 18

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9577
MDHGHMDHGHMGHDDMCSMNMLFTWDTTNLCIVFRQWHVRSTAALVFSLVAVVLLAMLYEALRALSRRYEASQNR
RIACMPRQTQQQAGQRAHVIKALLYALQNFYAFMLMLIFMTYNGWVMIAVSLGAFFGYLLFGQTTSATKDNACH*
Coding >Hirsu2|9577
ATGGACCACGGCCACATGGACCACGGCCACATGGGCCACGACGACATGTGCAGCATGAATATGCTCTTCACCTGG
GACACGACCAACCTCTGCATCGTCTTCCGCCAGTGGCACGTCCGCTCCACCGCCGCCCTCGTCTTCTCCCTCGTC
GCCGTCGTCCTGCTCGCCATGCTCTACGAGGCCCTGCGCGCCCTGTCGCGCCGCTACGAGGCCAGCCAGAACAGG
CGCATCGCCTGCATGCCCAGGCAGACCCAACAGCAGGCCGGCCAGCGCGCCCACGTCATCAAGGCTCTCCTCTAC
GCCTTGCAGAACTTTTACGCCTTTATGCTCATGCTCATCTTCATGACGTACAACGGCTGGGTCATGATCGCCGTC
TCCCTCGGCGCCTTTTTTGGATATCTTCTCTTTGGACAGACGACGTCGGCGACAAAGGACAACGCCTGCCACTAG
Transcript >Hirsu2|9577
ATGGACCACGGCCACATGGACCACGGCCACATGGGCCACGACGACATGTGCAGCATGAATATGCTCTTCACCTGG
GACACGACCAACCTCTGCATCGTCTTCCGCCAGTGGCACGTCCGCTCCACCGCCGCCCTCGTCTTCTCCCTCGTC
GCCGTCGTCCTGCTCGCCATGCTCTACGAGGCCCTGCGCGCCCTGTCGCGCCGCTACGAGGCCAGCCAGAACAGG
CGCATCGCCTGCATGCCCAGGCAGACCCAACAGCAGGCCGGCCAGCGCGCCCACGTCATCAAGGCTCTCCTCTAC
GCCTTGCAGAACTTTTACGCCTTTATGCTCATGCTCATCTTCATGACGTACAACGGCTGGGTCATGATCGCCGTC
TCCCTCGGCGCCTTTTTTGGATATCTTCTCTTTGGACAGACGACGTCGGCGACAAAGGACAACGCCTGCCACTAG
Gene >Hirsu2|9577
ATGGACCACGGCCACATGGACCACGGCCACATGGGCCACGACGACATGTGCAGCATGAATGTGCGTTTCTTTTTT
TTTTCCCTTGTACCCTCCGACTCTCGAATCTGCCATGTCGGCCTCGGCCGCTGACCCGAGACGCCCAAGATGCTC
TTCACCTGGGACACGACCAACCTCTGCATCGTCTTCCGCCAGTGGCACGTCCGCTCCACCGCCGCCCTCGTCTTC
TCCCTCGTCGCCGTCGTCCTGCTCGCCATGCTCTACGAGGCCCTGCGCGCCCTGTCGCGCCGCTACGAGGCCAGC
CAGAACAGGCGCATCGCCTGCATGCCCAGTGAGCAGCTCCTCTCCTCTCGCCCTCCTCCTCGGCCCCTATCCCAT
CTTCCCGCCCATCGATACCAAAGAGAGAGGGGGGGGAAAGAAAAGAAGAGAAAAAGAAAAGAAGAGGGGGGGGCT
TCGTGTTTTCCGTCATTGCGCCATTTCTCCCCTTGCGCTCCATGGGACCTATGCCAATGCTGAATGCGAAAACGC
CAAAACTCGGGATCCAAATCAAAAAGACGAGCAAATCATCCCTGCTGAGACCACCCCCTTCCTCTCCTCCCCAGG
GCAGACCCAACAGCAGGCCGGCCAGCGCGCCCACGTCATCAAGGCTCTCCTCTACGCCTTGCAGAACTTTTACGC
CTTTATGCTCATGTACGTTTTTTTCCCTCCCTTGCCAAGCCGGGCCGCTCCCGCTTGTCCTACGACCGCGCCGCG
CCCGCGAGGCTAAACTGTCGCCTCTGGCCCAGGCTCATCTTCATGACGTACAACGGCTGGGTCATGATCGCCGTC
TCCCTCGGCGCCTTTTTTGGATATCTTCTCTTTGGACAGACGACGTCGGCGACAAAGGACAACGCCTGCCACTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail