Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9575
Gene name
LocationContig_702:9421..10402
Strand+
Gene length (bp)981
Transcript length (bp)714
Coding sequence length (bp)714
Protein length (aa) 238

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01557 FAA_hydrolase Fumarylacetoacetate (FAA) hydrolase family 7.4E-47 25 214

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7L4|YOS9_SCHPO Uncharacterized hydrolase C21C3.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21C3.09c PE=3 SV=1 26 228 5.0E-65
sp|P53889|FMP41_YEAST Uncharacterized mitochondrial hydrolase FMP41 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMP41 PE=1 SV=1 26 237 2.0E-54
sp|Q86I22|FAHD1_DICDI Acylpyruvase FAHD1, mitochondrial OS=Dictyostelium discoideum GN=fahd1 PE=3 SV=1 27 210 2.0E-54
sp|Q2HJ98|FAHD1_BOVIN Acylpyruvase FAHD1, mitochondrial OS=Bos taurus GN=FAHD1 PE=2 SV=1 27 209 1.0E-51
sp|Q5RDW0|FAHD1_PONAB Acylpyruvase FAHD1, mitochondrial OS=Pongo abelii GN=FAHD1 PE=2 SV=1 27 209 7.0E-49
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7L4|YOS9_SCHPO Uncharacterized hydrolase C21C3.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21C3.09c PE=3 SV=1 26 228 5.0E-65
sp|P53889|FMP41_YEAST Uncharacterized mitochondrial hydrolase FMP41 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMP41 PE=1 SV=1 26 237 2.0E-54
sp|Q86I22|FAHD1_DICDI Acylpyruvase FAHD1, mitochondrial OS=Dictyostelium discoideum GN=fahd1 PE=3 SV=1 27 210 2.0E-54
sp|Q2HJ98|FAHD1_BOVIN Acylpyruvase FAHD1, mitochondrial OS=Bos taurus GN=FAHD1 PE=2 SV=1 27 209 1.0E-51
sp|Q5RDW0|FAHD1_PONAB Acylpyruvase FAHD1, mitochondrial OS=Pongo abelii GN=FAHD1 PE=2 SV=1 27 209 7.0E-49
sp|Q6P587|FAHD1_HUMAN Acylpyruvase FAHD1, mitochondrial OS=Homo sapiens GN=FAHD1 PE=1 SV=2 27 209 1.0E-48
sp|Q6AYQ8|FAHD1_RAT Acylpyruvase FAHD1, mitochondrial OS=Rattus norvegicus GN=Fahd1 PE=1 SV=1 27 232 1.0E-46
sp|Q8R0F8|FAHD1_MOUSE Acylpyruvase FAHD1, mitochondrial OS=Mus musculus GN=Fahd1 PE=1 SV=2 27 232 1.0E-46
sp|P34673|FAHD1_CAEEL Fumarylacetoacetate hydrolase domain-containing protein 1 OS=Caenorhabditis elegans GN=fahd-1 PE=3 SV=1 25 209 4.0E-45
sp|O58377|Y643_PYRHO Uncharacterized protein PH0643 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0643 PE=3 SV=1 27 209 1.0E-42
sp|Q9UYW0|Y1397_PYRAB Uncharacterized protein PYRAB13970 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB13970 PE=3 SV=1 27 207 3.0E-42
sp|P76004|YCGM_ECOLI Uncharacterized protein YcgM OS=Escherichia coli (strain K12) GN=ycgM PE=1 SV=1 27 203 3.0E-33
sp|Q59050|Y1656_METJA Uncharacterized protein MJ1656 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1656 PE=3 SV=1 27 209 3.0E-31
sp|Q5RCX5|FAHD2_PONAB Fumarylacetoacetate hydrolase domain-containing protein 2 OS=Pongo abelii GN=FAHD2 PE=2 SV=1 27 197 1.0E-28
sp|Q2KIB0|FAHD2_BOVIN Fumarylacetoacetate hydrolase domain-containing protein 2 OS=Bos taurus GN=FAHD2 PE=2 SV=1 27 197 6.0E-28
sp|Q96GK7|FAH2A_HUMAN Fumarylacetoacetate hydrolase domain-containing protein 2A OS=Homo sapiens GN=FAHD2A PE=1 SV=1 27 197 1.0E-27
sp|Q6P2I3|FAH2B_HUMAN Fumarylacetoacetate hydrolase domain-containing protein 2B OS=Homo sapiens GN=FAHD2B PE=1 SV=1 27 197 8.0E-27
sp|O86042|NAGK_RALSP Fumarylpyruvate hydrolase OS=Ralstonia sp. GN=nagK PE=1 SV=1 33 203 6.0E-26
sp|B2RYW9|FAHD2_RAT Fumarylacetoacetate hydrolase domain-containing protein 2 OS=Rattus norvegicus GN=Fahd2 PE=1 SV=1 27 197 6.0E-26
sp|Q3TC72|FAHD2_MOUSE Fumarylacetoacetate hydrolase domain-containing protein 2A OS=Mus musculus GN=Fahd2 PE=1 SV=1 27 197 1.0E-25
sp|Q6GLT8|FAHD2_XENLA Fumarylacetoacetate hydrolase domain-containing protein 2 OS=Xenopus laevis GN=fahd2 PE=2 SV=1 27 214 2.0E-25
sp|B1Z1Y2|UGL_BURA4 Ureidoglycolate lyase OS=Burkholderia ambifaria (strain MC40-6) GN=BamMC406_5393 PE=3 SV=1 27 197 3.0E-25
sp|Q0B628|UGL_BURCM Ureidoglycolate lyase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=Bamb_4846 PE=3 SV=1 27 197 4.0E-25
sp|A9ALD1|UGL_BURM1 Ureidoglycolate lyase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=Bmul_3283 PE=3 SV=1 27 197 4.0E-25
sp|Q39BA7|UGL_BURL3 Ureidoglycolate lyase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=Bcep18194_B0137 PE=1 SV=1 27 197 5.0E-25
sp|B4EKX6|UGL_BURCJ Ureidoglycolate lyase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=BceJ2315_61450 PE=3 SV=1 27 197 6.0E-25
sp|Q1BJJ1|UGL_BURCA Ureidoglycolate lyase OS=Burkholderia cenocepacia (strain AU 1054) GN=Bcen_5340 PE=3 SV=1 27 197 7.0E-25
sp|B1K3Y3|UGL_BURCC Ureidoglycolate lyase OS=Burkholderia cenocepacia (strain MC0-3) GN=Bcenmc03_4750 PE=3 SV=1 27 197 7.0E-25
sp|A0B3M8|UGL_BURCH Ureidoglycolate lyase OS=Burkholderia cenocepacia (strain HI2424) GN=Bcen2424_5521 PE=3 SV=1 27 197 7.0E-25
sp|Q9RPU5|HPAG_SALDU 4-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase OS=Salmonella dublin GN=hpaG PE=3 SV=1 27 203 9.0E-25
sp|P37352|HPCE_ECOLX Homoprotocatechuate catabolism bifunctional isomerase/decarboxylase OS=Escherichia coli GN=hpcE PE=1 SV=2 27 197 2.0E-23
sp|Q46978|HPAG_ECOLX 4-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase OS=Escherichia coli GN=hpaG PE=3 SV=1 27 197 2.0E-23
sp|O28058|Y2225_ARCFU Uncharacterized protein AF_2225 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_2225 PE=3 SV=1 27 206 4.0E-23
sp|Q54BF3|FAHD2_DICDI Fumarylacetoacetate hydrolase domain-containing protein 2 homolog OS=Dictyostelium discoideum GN=fahd2 PE=3 SV=1 25 216 8.0E-23
sp|O06724|YISK_BACSU Uncharacterized protein YisK OS=Bacillus subtilis (strain 168) GN=yisK PE=2 SV=1 25 208 7.0E-19
sp|Q5HHB6|Y973_STAAC Uncharacterized protein SACOL0973 OS=Staphylococcus aureus (strain COL) GN=SACOL0973 PE=3 SV=1 25 197 2.0E-15
sp|Q7A6H3|Y829_STAAN Uncharacterized protein SA0829 OS=Staphylococcus aureus (strain N315) GN=SA0829 PE=1 SV=1 25 197 2.0E-15
sp|Q2YWW3|Y837_STAAB Uncharacterized protein SAB0837 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB0837 PE=3 SV=1 25 197 2.0E-15
sp|Q6GAV8|Y838_STAAS Uncharacterized protein SAS0838 OS=Staphylococcus aureus (strain MSSA476) GN=SAS0838 PE=3 SV=1 25 197 2.0E-15
sp|Q7A1B6|Y850_STAAW Uncharacterized protein MW0850 OS=Staphylococcus aureus (strain MW2) GN=MW0850 PE=3 SV=1 25 197 2.0E-15
sp|Q2FIA7|Y871_STAA3 Uncharacterized protein SAUSA300_0871 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_0871 PE=3 SV=1 25 197 2.0E-15
sp|Q2FZT4|Y906_STAA8 Uncharacterized protein SAOUHSC_00906 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_00906 PE=3 SV=1 25 197 2.0E-15
sp|Q99VC2|Y968_STAAM Uncharacterized protein SAV0968 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV0968 PE=3 SV=1 25 197 2.0E-15
sp|Q4L4Y4|Y1982_STAHJ Uncharacterized protein SH1982 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH1982 PE=3 SV=1 25 197 4.0E-15
sp|Q49WA8|Y1806_STAS1 Uncharacterized protein SSP1806 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1806 PE=3 SV=1 25 209 5.0E-15
sp|Q6GIC0|Y930_STAAR Uncharacterized protein SAR0930 OS=Staphylococcus aureus (strain MRSA252) GN=SAR0930 PE=3 SV=1 25 197 5.0E-15
sp|Q8CPT8|Y665_STAES Uncharacterized protein SE_0665 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_0665 PE=3 SV=1 27 197 4.0E-14
sp|Q5HQJ3|Y556_STAEQ Uncharacterized protein SERP0556 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP0556 PE=3 SV=1 27 197 4.0E-14
sp|P37352|HPCE_ECOLX Homoprotocatechuate catabolism bifunctional isomerase/decarboxylase OS=Escherichia coli GN=hpcE PE=1 SV=2 34 206 1.0E-09
sp|Q46978|HPAG_ECOLX 4-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase OS=Escherichia coli GN=hpaG PE=3 SV=1 34 206 3.0E-09
sp|Q9RPU5|HPAG_SALDU 4-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase OS=Salmonella dublin GN=hpaG PE=3 SV=1 33 206 2.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9575
MKFILATLALFVGAATAAPAPHAGRAHVAELRNATPKQPFFFLKPPSAMLLPGEGPCLRPRGVELHFEVELALVL
GRAVRGLAPDDERGALDAIDAYAVAIDMTARNAQDEAKRKGLPWTTAKGFDTFLPMSAPIPKRAVADPHDAELFL
DVNGAPRQRASTGLMLYRIPRILSDISRVMALLPGDVVLTGTPAGVGPVVPGDVMRAGLVVAGAEVPEGRVEVRV
EESPSSYVFSET*
Coding >Hirsu2|9575
ATGAAGTTCATCCTGGCAACGCTGGCCCTGTTCGTCGGCGCCGCCACGGCGGCCCCGGCACCACACGCGGGCAGG
GCGCACGTGGCGGAGCTGCGCAACGCGACGCCCAAGCAGCCCTTCTTCTTCCTCAAGCCGCCGTCGGCGATGCTG
CTGCCGGGCGAGGGCCCGTGCCTGCGCCCGCGCGGCGTCGAGCTGCACTTTGAGGTCGAGCTGGCGCTGGTGCTG
GGCCGGGCGGTGCGCGGGCTGGCGCCGGACGATGAGCGGGGGGCGCTCGACGCCATCGACGCCTACGCCGTCGCC
ATCGACATGACGGCCCGCAACGCCCAGGACGAGGCCAAGCGCAAGGGCCTGCCGTGGACGACGGCCAAGGGTTTC
GACACCTTCCTGCCCATGAGCGCGCCCATCCCGAAGCGGGCCGTGGCCGACCCGCACGACGCCGAGCTCTTCCTC
GACGTCAACGGCGCGCCGCGGCAGCGCGCCTCCACCGGCCTCATGCTGTACCGCATCCCGCGCATCCTCAGCGAC
ATCTCGCGCGTCATGGCCCTGCTGCCCGGCGACGTCGTCCTGACCGGCACCCCGGCCGGCGTCGGGCCCGTCGTG
CCCGGCGACGTCATGCGCGCGGGCCTCGTCGTCGCTGGCGCCGAGGTGCCCGAGGGCCGCGTCGAGGTCCGCGTC
GAGGAATCGCCCTCCTCCTACGTCTTTTCCGAGACCTGA
Transcript >Hirsu2|9575
ATGAAGTTCATCCTGGCAACGCTGGCCCTGTTCGTCGGCGCCGCCACGGCGGCCCCGGCACCACACGCGGGCAGG
GCGCACGTGGCGGAGCTGCGCAACGCGACGCCCAAGCAGCCCTTCTTCTTCCTCAAGCCGCCGTCGGCGATGCTG
CTGCCGGGCGAGGGCCCGTGCCTGCGCCCGCGCGGCGTCGAGCTGCACTTTGAGGTCGAGCTGGCGCTGGTGCTG
GGCCGGGCGGTGCGCGGGCTGGCGCCGGACGATGAGCGGGGGGCGCTCGACGCCATCGACGCCTACGCCGTCGCC
ATCGACATGACGGCCCGCAACGCCCAGGACGAGGCCAAGCGCAAGGGCCTGCCGTGGACGACGGCCAAGGGTTTC
GACACCTTCCTGCCCATGAGCGCGCCCATCCCGAAGCGGGCCGTGGCCGACCCGCACGACGCCGAGCTCTTCCTC
GACGTCAACGGCGCGCCGCGGCAGCGCGCCTCCACCGGCCTCATGCTGTACCGCATCCCGCGCATCCTCAGCGAC
ATCTCGCGCGTCATGGCCCTGCTGCCCGGCGACGTCGTCCTGACCGGCACCCCGGCCGGCGTCGGGCCCGTCGTG
CCCGGCGACGTCATGCGCGCGGGCCTCGTCGTCGCTGGCGCCGAGGTGCCCGAGGGCCGCGTCGAGGTCCGCGTC
GAGGAATCGCCCTCCTCCTACGTCTTTTCCGAGACCTGA
Gene >Hirsu2|9575
ATGAAGTTCATCCTGGCAACGCTGGCCCTGTTCGTCGGCGCCGCCACGGCGGCCCCGGCACCACACGGTACGTCG
ACGCCCTCTCTGTCTCGCCCGGCGCGGACGAGACACACAGAGAGAGAGAGAGAGATAGAAAGAGAGAGGGCAAGG
CTGACGGGGAGCGGGAGCGGGCAGGGCGCACGTGGCGGAGCTGCGCAACGCGACGCCCAAGCAGCCCTTCTTCTT
CCTCAAGCCGCCGTCGGCGATGCTGCTGCCGGGCGAGGGCCCGTGCCTGCGCCCGCGCGGCGTCGAGCTGCACTT
TGAGGTCGAGCTGGCGCTGGTGCTGGGCCGGGCGGTGCGCGGGCTGGCGCCGGACGATGAGCGGGGGGCGCTCGA
CGCCATCGACGGTTCGTCTCTCGCTTTCTTGAGCCCTCTGTCTCTTGAGCCGTCTCTTGAGCCCCCGCACTCTCT
CTGCCTCTGTCTCCGTCTCTGCCTCGTCGTCTCTCGCCACCTCGTCGTCGTCTTGCGCAGCAGCAGCAGCAGCTG
ACAGACTACAAAATCAAAAAACGGACAGCCTACGCCGTCGCCATCGACATGACGGCCCGCAACGCCCAGGACGAG
GCCAAGCGCAAGGGCCTGCCGTGGACGACGGCCAAGGGTTTCGACACCTTCCTGCCCATGAGCGCGCCCATCCCG
AAGCGGGCCGTGGCCGACCCGCACGACGCCGAGCTCTTCCTCGACGTCAACGGCGCGCCGCGGCAGCGCGCCTCC
ACCGGCCTCATGCTGTACCGCATCCCGCGCATCCTCAGCGACATCTCGCGCGTCATGGCCCTGCTGCCCGGCGAC
GTCGTCCTGACCGGCACCCCGGCCGGCGTCGGGCCCGTCGTGCCCGGCGACGTCATGCGCGCGGGCCTCGTCGTC
GCTGGCGCCGAGGTGCCCGAGGGCCGCGTCGAGGTCCGCGTCGAGGAATCGCCCTCCTCCTACGTCTTTTCCGAG
ACCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail