Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9571
Gene name
LocationContig_702:560..2214
Strand+
Gene length (bp)1654
Transcript length (bp)1587
Coding sequence length (bp)1587
Protein length (aa) 529

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01757 Acyl_transf_3 Acyltransferase family 1.9E-38 105 507

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016747 transferase activity, transferring acyl groups other than amino-acyl groups Yes
GO:0016746 transferase activity, transferring acyl groups No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.5

Transmembrane Domains

Domain # Start End Length
1 153 172 19
2 199 221 22
3 279 301 22
4 480 502 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9571
MSGLPPSRTSFSEKMGLLNERAVSSDTESEADVAEVEQVADRWGLLSAKLYLAHFSSSLAALWDYLFSTSWRLWF
LRLANFLVPSFLQGRHAREQICPAKLSPTAYLDGMRGLAALFVYFCHYSYQGFTIAKSWGCADSNYEVFKLPFLR
LWYQGPQAVCVFFVISGYALSYRPLKLIRSRSISEFSTTMSSLVFRRGLRLYLPTAVSTLLIVCLLRVGAYEWTR
DFANDRTYMRNIIEPHPLRMDNTYHQFRDWALHMYKFVHVFGWERFGGTTSYDVHLWTIPVEFRCSLYLFLVILG
TARLQAKLRVLTVGGVMWFAYRHSRWDFLLFLGGMVLAEWDLARDAHASPPALPQDEKTVERPAQPLWKRLFWIS
VSILGLYLLCQPDDGGDVTPGWRFLTSMIPSWWAEESYRYWQSAGAVVFVAAVGHTGGWQHFFNLPAIQYLGKIS
YALYLMHGPAMHTVGYHFEKWAYSLTGVDGYWYNAGFALGACFCVPITIWWADVFWRAVDVPSVKFAKWVERRCV
GKN*
Coding >Hirsu2|9571
ATGAGCGGACTCCCCCCCTCGCGGACCTCCTTCTCGGAGAAGATGGGCCTCCTCAACGAGCGTGCCGTCTCCTCC
GACACGGAGAGCGAGGCCGACGTCGCCGAGGTTGAACAGGTCGCCGACCGATGGGGCCTGCTCTCCGCCAAGCTG
TATCTCGCCCACTTCTCGTCCTCGCTCGCCGCCCTCTGGGACTACCTCTTCTCGACCTCGTGGCGCCTCTGGTTC
CTCCGCCTCGCCAACTTCCTCGTCCCCAGCTTCCTGCAGGGCCGCCACGCCCGCGAGCAGATATGCCCGGCCAAG
CTGTCGCCCACGGCCTACCTCGACGGCATGCGCGGCCTGGCCGCCCTCTTCGTCTACTTCTGCCACTACTCGTAC
CAGGGCTTCACCATCGCCAAGAGCTGGGGCTGCGCCGACTCCAACTACGAGGTCTTCAAGCTGCCCTTCCTCCGC
CTGTGGTATCAGGGCCCCCAGGCCGTCTGCGTCTTCTTCGTCATCTCCGGCTACGCCCTGTCGTATCGTCCCCTG
AAACTCATCCGCAGCCGCTCCATCTCCGAGTTCTCCACCACCATGAGCTCCCTCGTCTTCCGCCGCGGCCTCCGC
CTGTACCTGCCCACGGCCGTCTCGACCCTGCTCATCGTCTGCCTCCTGCGCGTCGGCGCCTACGAGTGGACCCGC
GACTTCGCCAATGACCGGACCTACATGCGCAACATCATCGAGCCGCACCCTCTTCGCATGGACAACACCTACCAC
CAGTTCCGCGACTGGGCTCTGCACATGTACAAGTTCGTCCACGTCTTCGGCTGGGAGAGGTTTGGCGGAACCACT
TCTTACGACGTGCACCTGTGGACCATTCCCGTCGAGTTCCGGTGCTCCCTCTACCTGTTCCTCGTCATCCTCGGC
ACCGCCCGCCTGCAGGCCAAGCTCCGCGTCCTCACCGTCGGCGGTGTCATGTGGTTCGCCTACCGCCACTCCCGC
TGGGACTTCCTCCTCTTCCTCGGCGGCATGGTCCTTGCCGAGTGGGATCTCGCCCGGGACGCCCACGCCAGCCCT
CCCGCCTTGCCCCAGGACGAGAAGACGGTCGAGAGGCCGGCCCAGCCGCTGTGGAAGAGGCTTTTCTGGATCTCG
GTCAGCATCCTCGGCCTCTACCTCCTCTGCCAGCCCGACGACGGGGGCGACGTGACGCCCGGGTGGCGCTTCCTG
ACGTCGATGATCCCGTCGTGGTGGGCTGAGGAGTCGTACCGATACTGGCAGTCGGCCGGCGCCGTCGTCTTCGTG
GCCGCCGTCGGGCACACGGGCGGCTGGCAGCACTTCTTCAACCTGCCCGCGATACAATACCTCGGCAAGATCTCG
TACGCCCTGTACCTCATGCACGGGCCTGCCATGCACACGGTCGGCTATCACTTCGAGAAGTGGGCGTACAGCCTG
ACGGGTGTGGACGGCTACTGGTACAATGCGGGCTTCGCGCTGGGCGCTTGCTTCTGCGTGCCCATCACCATCTGG
TGGGCCGACGTGTTCTGGAGGGCCGTCGACGTGCCGTCGGTCAAGTTTGCCAAGTGGGTGGAGCGGAGGTGTGTG
GGCAAGAACTGA
Transcript >Hirsu2|9571
ATGAGCGGACTCCCCCCCTCGCGGACCTCCTTCTCGGAGAAGATGGGCCTCCTCAACGAGCGTGCCGTCTCCTCC
GACACGGAGAGCGAGGCCGACGTCGCCGAGGTTGAACAGGTCGCCGACCGATGGGGCCTGCTCTCCGCCAAGCTG
TATCTCGCCCACTTCTCGTCCTCGCTCGCCGCCCTCTGGGACTACCTCTTCTCGACCTCGTGGCGCCTCTGGTTC
CTCCGCCTCGCCAACTTCCTCGTCCCCAGCTTCCTGCAGGGCCGCCACGCCCGCGAGCAGATATGCCCGGCCAAG
CTGTCGCCCACGGCCTACCTCGACGGCATGCGCGGCCTGGCCGCCCTCTTCGTCTACTTCTGCCACTACTCGTAC
CAGGGCTTCACCATCGCCAAGAGCTGGGGCTGCGCCGACTCCAACTACGAGGTCTTCAAGCTGCCCTTCCTCCGC
CTGTGGTATCAGGGCCCCCAGGCCGTCTGCGTCTTCTTCGTCATCTCCGGCTACGCCCTGTCGTATCGTCCCCTG
AAACTCATCCGCAGCCGCTCCATCTCCGAGTTCTCCACCACCATGAGCTCCCTCGTCTTCCGCCGCGGCCTCCGC
CTGTACCTGCCCACGGCCGTCTCGACCCTGCTCATCGTCTGCCTCCTGCGCGTCGGCGCCTACGAGTGGACCCGC
GACTTCGCCAATGACCGGACCTACATGCGCAACATCATCGAGCCGCACCCTCTTCGCATGGACAACACCTACCAC
CAGTTCCGCGACTGGGCTCTGCACATGTACAAGTTCGTCCACGTCTTCGGCTGGGAGAGGTTTGGCGGAACCACT
TCTTACGACGTGCACCTGTGGACCATTCCCGTCGAGTTCCGGTGCTCCCTCTACCTGTTCCTCGTCATCCTCGGC
ACCGCCCGCCTGCAGGCCAAGCTCCGCGTCCTCACCGTCGGCGGTGTCATGTGGTTCGCCTACCGCCACTCCCGC
TGGGACTTCCTCCTCTTCCTCGGCGGCATGGTCCTTGCCGAGTGGGATCTCGCCCGGGACGCCCACGCCAGCCCT
CCCGCCTTGCCCCAGGACGAGAAGACGGTCGAGAGGCCGGCCCAGCCGCTGTGGAAGAGGCTTTTCTGGATCTCG
GTCAGCATCCTCGGCCTCTACCTCCTCTGCCAGCCCGACGACGGGGGCGACGTGACGCCCGGGTGGCGCTTCCTG
ACGTCGATGATCCCGTCGTGGTGGGCTGAGGAGTCGTACCGATACTGGCAGTCGGCCGGCGCCGTCGTCTTCGTG
GCCGCCGTCGGGCACACGGGCGGCTGGCAGCACTTCTTCAACCTGCCCGCGATACAATACCTCGGCAAGATCTCG
TACGCCCTGTACCTCATGCACGGGCCTGCCATGCACACGGTCGGCTATCACTTCGAGAAGTGGGCGTACAGCCTG
ACGGGTGTGGACGGCTACTGGTACAATGCGGGCTTCGCGCTGGGCGCTTGCTTCTGCGTGCCCATCACCATCTGG
TGGGCCGACGTGTTCTGGAGGGCCGTCGACGTGCCGTCGGTCAAGTTTGCCAAGTGGGTGGAGCGGAGGTGTGTG
GGCAAGAACTGA
Gene >Hirsu2|9571
ATGAGCGGACTCCCCCCCTCGCGGACCTCCTTCTCGGAGAAGATGGGCCTCCTCAACGAGCGTGCCGTCTCCTCC
GACACGGAGAGCGAGGCCGACGTCGCCGAGGTTGAACAGGTCGCCGACCGATGGGGCCTGCTCTCCGCCAAGCTG
TATCTCGCCCACTTCTCGTCCTCGCTCGCCGCCCTCTGGGACTACCTCTTCTCGACCTCGTGGCGCCTCTGGTTC
CTCCGCCTCGCCAACTTCCTCGTCCCCAGCTTCCTGCAGGGCCGCCACGCCCGCGAGCAGATATGCCCGGCCAAG
CTGTCGCCCACGGCCTACCTCGACGGCATGCGCGGCCTGGCCGCCCTCTTCGTCTACTTCTGCCACTACTCGTAC
CAGGGCTTCACCATCGCCAAGAGCTGGGGCTGCGCCGACTCCAACTACGAGGTCTTCAAGCTGCCCTTCCTCCGC
CTGTGGTATCAGGGCCCCCAGGCCGTCTGCGTCTTCTTCGTCATCTCCGGCTACGCCCTGTCGTATCGTCCCCTG
AAACTCATCCGCAGCCGCTCCATCTCCGAGTTCTCCACCACCATGAGCTCCCTCGTCTTCCGCCGCGGCCTCCGC
CTGTACCTGCCCACGGCCGTCTCGACCCTGCTCATCGTCTGCCTCCTGCGCGTCGGCGCCTACGAGTGGACCCGC
GACTTCGCCAATGACCGGACCTACATGCGCAACATCATCGAGCCGCACCCTCTTCGCATGGACAACACCTACCAC
CAGTTCCGCGACTGGGCTCTGCACATGTACAAGTTCGTCCACGTCTTCGGCTGGGAGAGGTTTGGCGGAACCACT
TGTAAGAGCCCCACCCCTGCCTCTGGGCTGCCGTCTCGCCCCTGTCCTCGCTAACGCCCCTCGTACAGCTTACGA
CGTGCACCTGTGGACCATTCCCGTCGAGTTCCGGTGCTCCCTCTACCTGTTCCTCGTCATCCTCGGCACCGCCCG
CCTGCAGGCCAAGCTCCGCGTCCTCACCGTCGGCGGTGTCATGTGGTTCGCCTACCGCCACTCCCGCTGGGACTT
CCTCCTCTTCCTCGGCGGCATGGTCCTTGCCGAGTGGGATCTCGCCCGGGACGCCCACGCCAGCCCTCCCGCCTT
GCCCCAGGACGAGAAGACGGTCGAGAGGCCGGCCCAGCCGCTGTGGAAGAGGCTTTTCTGGATCTCGGTCAGCAT
CCTCGGCCTCTACCTCCTCTGCCAGCCCGACGACGGGGGCGACGTGACGCCCGGGTGGCGCTTCCTGACGTCGAT
GATCCCGTCGTGGTGGGCTGAGGAGTCGTACCGATACTGGCAGTCGGCCGGCGCCGTCGTCTTCGTGGCCGCCGT
CGGGCACACGGGCGGCTGGCAGCACTTCTTCAACCTGCCCGCGATACAATACCTCGGCAAGATCTCGTACGCCCT
GTACCTCATGCACGGGCCTGCCATGCACACGGTCGGCTATCACTTCGAGAAGTGGGCGTACAGCCTGACGGGTGT
GGACGGCTACTGGTACAATGCGGGCTTCGCGCTGGGCGCTTGCTTCTGCGTGCCCATCACCATCTGGTGGGCCGA
CGTGTTCTGGAGGGCCGTCGACGTGCCGTCGGTCAAGTTTGCCAAGTGGGTGGAGCGGAGGTGTGTGGGCAAGAA
CTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail