Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9568
Gene name
LocationContig_700:10354..13249
Strand+
Gene length (bp)2895
Transcript length (bp)2667
Coding sequence length (bp)2667
Protein length (aa) 889

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11838 ERAP1_C ERAP1-like C-terminal domain 3.3E-85 547 864
PF01433 Peptidase_M1 Peptidase family M1 domain 2.9E-85 256 473
PF17900 Peptidase_M1_N Peptidase M1 N-terminal domain 4.1E-49 31 221

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q59KZ1|APE2_CANAL Aminopeptidase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=APE2 PE=1 SV=2 1 886 0.0E+00
sp|P32454|APE2_YEAST Aminopeptidase 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APE2 PE=1 SV=4 22 886 0.0E+00
sp|P37898|AAP1_YEAST Alanine/arginine aminopeptidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AAP1 PE=1 SV=2 23 886 0.0E+00
sp|Q9USX1|APE1_SCHPO Aminopeptidase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ape1 PE=3 SV=1 21 886 0.0E+00
sp|Q0J2B5|APM1C_ORYSJ Aminopeptidase M1-C OS=Oryza sativa subsp. japonica GN=Os09g0362500 PE=2 SV=2 26 870 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q59KZ1|APE2_CANAL Aminopeptidase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=APE2 PE=1 SV=2 1 886 0.0E+00
sp|P32454|APE2_YEAST Aminopeptidase 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APE2 PE=1 SV=4 22 886 0.0E+00
sp|P37898|AAP1_YEAST Alanine/arginine aminopeptidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AAP1 PE=1 SV=2 23 886 0.0E+00
sp|Q9USX1|APE1_SCHPO Aminopeptidase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ape1 PE=3 SV=1 21 886 0.0E+00
sp|Q0J2B5|APM1C_ORYSJ Aminopeptidase M1-C OS=Oryza sativa subsp. japonica GN=Os09g0362500 PE=2 SV=2 26 870 0.0E+00
sp|P55786|PSA_HUMAN Puromycin-sensitive aminopeptidase OS=Homo sapiens GN=NPEPPS PE=1 SV=2 15 881 0.0E+00
sp|Q6K4E7|APM1D_ORYSJ Aminopeptidase M1-D OS=Oryza sativa subsp. japonica GN=Os09g0362800 PE=2 SV=1 14 870 0.0E+00
sp|Q11011|PSA_MOUSE Puromycin-sensitive aminopeptidase OS=Mus musculus GN=Npepps PE=1 SV=2 17 881 0.0E+00
sp|Q6Z6L4|APM1A_ORYSJ Aminopeptidase M1-A OS=Oryza sativa subsp. japonica GN=Os02g0218200 PE=2 SV=1 26 876 0.0E+00
sp|Q8VZH2|APM1_ARATH Aminopeptidase M1 OS=Arabidopsis thaliana GN=APM1 PE=1 SV=1 26 870 4.0E-178
sp|Q0J5V5|APM1B_ORYSJ Aminopeptidase M1-B OS=Oryza sativa subsp. japonica GN=Os08g0398700 PE=2 SV=1 17 876 2.0E-170
sp|Q07075|AMPE_HUMAN Glutamyl aminopeptidase OS=Homo sapiens GN=ENPEP PE=1 SV=3 26 881 9.0E-147
sp|Q32LQ0|AMPE_BOVIN Glutamyl aminopeptidase OS=Bos taurus GN=ENPEP PE=2 SV=1 26 885 3.0E-142
sp|Q95334|AMPE_PIG Glutamyl aminopeptidase OS=Sus scrofa GN=ENPEP PE=1 SV=1 16 881 8.0E-141
sp|P15684|AMPN_RAT Aminopeptidase N OS=Rattus norvegicus GN=Anpep PE=1 SV=2 18 885 1.0E-138
sp|P16406|AMPE_MOUSE Glutamyl aminopeptidase OS=Mus musculus GN=Enpep PE=1 SV=1 26 883 4.0E-138
sp|P50123|AMPE_RAT Glutamyl aminopeptidase OS=Rattus norvegicus GN=Enpep PE=1 SV=2 26 883 7.0E-138
sp|P97449|AMPN_MOUSE Aminopeptidase N OS=Mus musculus GN=Anpep PE=1 SV=4 18 885 2.0E-137
sp|P15541|AMPN_RABIT Aminopeptidase N OS=Oryctolagus cuniculus GN=ANPEP PE=1 SV=4 20 885 3.0E-135
sp|O57579|AMPN_CHICK Aminopeptidase Ey OS=Gallus gallus GN=ANPEP PE=1 SV=1 19 883 1.0E-133
sp|P79098|AMPN_BOVIN Aminopeptidase N OS=Bos taurus GN=ANPEP PE=2 SV=4 18 882 2.0E-132
sp|P15145|AMPN_PIG Aminopeptidase N OS=Sus scrofa GN=ANPEP PE=1 SV=4 18 881 2.0E-132
sp|Q9JJ22|ERAP1_RAT Endoplasmic reticulum aminopeptidase 1 OS=Rattus norvegicus GN=Erap1 PE=2 SV=2 2 882 1.0E-130
sp|P79171|AMPN_FELCA Aminopeptidase N OS=Felis catus GN=ANPEP PE=1 SV=3 18 885 6.0E-130
sp|P15144|AMPN_HUMAN Aminopeptidase N OS=Homo sapiens GN=ANPEP PE=1 SV=4 22 885 2.0E-128
sp|Q9NZ08|ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1 OS=Homo sapiens GN=ERAP1 PE=1 SV=3 20 883 1.0E-125
sp|Q9EQH2|ERAP1_MOUSE Endoplasmic reticulum aminopeptidase 1 OS=Mus musculus GN=Erap1 PE=1 SV=2 2 882 7.0E-122
sp|A6QPT7|ERAP2_BOVIN Endoplasmic reticulum aminopeptidase 2 OS=Bos taurus GN=ERAP2 PE=2 SV=1 26 881 1.0E-117
sp|Q6P179|ERAP2_HUMAN Endoplasmic reticulum aminopeptidase 2 OS=Homo sapiens GN=ERAP2 PE=1 SV=2 26 884 1.0E-117
sp|Q5RFP3|ERAP2_PONAB Endoplasmic reticulum aminopeptidase 2 OS=Pongo abelii GN=ERAP2 PE=2 SV=1 26 884 2.0E-117
sp|A6NEC2|PSAL_HUMAN Puromycin-sensitive aminopeptidase-like protein OS=Homo sapiens GN=NPEPPSL1 PE=2 SV=3 15 454 1.0E-116
sp|Q8C129|LCAP_MOUSE Leucyl-cystinyl aminopeptidase OS=Mus musculus GN=Lnpep PE=1 SV=1 26 881 2.0E-116
sp|Q97AJ6|TRF3_THEVO Tricorn protease-interacting factor F3 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=trf3 PE=3 SV=1 69 655 3.0E-116
sp|O93655|TRF3_THEAC Tricorn protease-interacting factor F3 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=trf3 PE=1 SV=1 35 799 8.0E-116
sp|Q10737|AMPN_HAECO Aminopeptidase N OS=Haemonchus contortus PE=2 SV=2 5 882 9.0E-116
sp|P97629|LCAP_RAT Leucyl-cystinyl aminopeptidase OS=Rattus norvegicus GN=Lnpep PE=1 SV=1 26 881 2.0E-115
sp|Q9UIQ6|LCAP_HUMAN Leucyl-cystinyl aminopeptidase OS=Homo sapiens GN=LNPEP PE=1 SV=3 26 881 2.0E-113
sp|P95928|APE2_SULSO Leucyl aminopeptidase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=ape2 PE=1 SV=1 56 811 6.0E-113
sp|Q978U3|TRF2_THEVO Tricorn protease-interacting factor F2 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=trf2 PE=3 SV=1 34 631 1.0E-112
sp|Q974N6|APE2_SULTO Probable aminopeptidase 2 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=ape2 PE=3 SV=1 35 781 8.0E-111
sp|O93654|TRF2_THEAC Tricorn protease-interacting factor F2 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=trf2 PE=1 SV=1 35 628 4.0E-109
sp|Q8SRG3|AMP12_ENCCU Probable M1 family aminopeptidase 2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU08_0070 PE=3 SV=1 19 874 4.0E-108
sp|Q8SQI6|AMP11_ENCCU Probable M1 family aminopeptidase 1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU01_0140 PE=3 SV=1 19 874 5.0E-108
sp|Q97VF1|APE1_SULSO Probable aminopeptidase 1 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=ape1 PE=3 SV=1 101 809 6.0E-105
sp|Q10836|TRHDE_RAT Thyrotropin-releasing hormone-degrading ectoenzyme OS=Rattus norvegicus GN=Trhde PE=1 SV=1 9 881 7.0E-101
sp|Q9UKU6|TRHDE_HUMAN Thyrotropin-releasing hormone-degrading ectoenzyme OS=Homo sapiens GN=TRHDE PE=2 SV=1 26 881 2.0E-99
sp|Q8K093|TRHDE_MOUSE Thyrotropin-releasing hormone-degrading ectoenzyme OS=Mus musculus GN=Trhde PE=1 SV=1 20 881 4.0E-99
sp|Q48656|AMPN_LACLL Aminopeptidase N OS=Lactococcus lactis subsp. lactis GN=pepN PE=1 SV=2 31 882 6.0E-99
sp|Q96ZT9|APE1_SULTO Probable aminopeptidase 1 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=ape1 PE=3 SV=1 116 809 1.0E-96
sp|P37896|AMPN_LACDL Aminopeptidase N OS=Lactobacillus delbrueckii subsp. lactis GN=pepN PE=1 SV=3 32 847 7.0E-95
sp|P91887|AMPN_PLUXY Aminopeptidase N OS=Plutella xylostella GN=APN1 PE=1 SV=1 8 884 1.0E-93
sp|Q6Q4G3|AMPQ_HUMAN Aminopeptidase Q OS=Homo sapiens GN=LVRN PE=1 SV=4 5 884 5.0E-93
sp|Q10730|AMPN_LACHE Aminopeptidase N OS=Lactobacillus helveticus GN=pepN PE=3 SV=1 32 847 6.0E-92
sp|P91885|AMPN_MANSE Aminopeptidase N OS=Manduca sexta GN=APN2 PE=1 SV=2 25 887 5.0E-89
sp|Q11001|AMPM_MANSE Membrane alanyl aminopeptidase (Fragment) OS=Manduca sexta PE=1 SV=1 26 844 1.0E-85
sp|Q9CIQ1|AMPN_LACLA Aminopeptidase N OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=pepN PE=3 SV=1 26 877 1.0E-82
sp|P0C2T8|AMPN_LACLC Aminopeptidase N OS=Lactococcus lactis subsp. cremoris GN=pepN PE=1 SV=1 108 877 1.0E-82
sp|A2RI32|AMPN_LACLM Aminopeptidase N OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=pepN PE=1 SV=1 26 877 2.0E-82
sp|Q11000|AMPM_HELVI Membrane alanyl aminopeptidase OS=Heliothis virescens PE=1 SV=1 26 768 2.0E-75
sp|Q2KHK3|AMPQ_MOUSE Aminopeptidase Q OS=Mus musculus GN=Lvrn PE=1 SV=3 15 455 3.0E-74
sp|Q10736|AMPN_ACEPA Aminopeptidase N (Fragment) OS=Acetobacter pasteurianus GN=pepN PE=3 SV=1 26 356 4.0E-68
sp|P40462|TM108_YEAST Protein TMA108 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TMA108 PE=1 SV=1 30 774 7.0E-63
sp|Q11010|AMPN_STRLI Aminopeptidase N OS=Streptomyces lividans GN=pepN PE=1 SV=1 150 482 8.0E-52
sp|Q17405|YQ02_CAEEL Aminopeptidase-like protein AC3.5 OS=Caenorhabditis elegans GN=AC3.5 PE=1 SV=2 20 881 4.0E-45
sp|O96935|AMP1_PLAFQ M1 family aminopeptidase OS=Plasmodium falciparum (isolate FcB1 / Columbia) PE=1 SV=2 78 521 1.0E-29
sp|P37893|AMPN_CAUCR Aminopeptidase N OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=pepN PE=3 SV=2 64 526 6.0E-26
sp|P24527|LKHA4_MOUSE Leukotriene A-4 hydrolase OS=Mus musculus GN=Lta4h PE=1 SV=4 27 458 5.0E-23
sp|P30349|LKHA4_RAT Leukotriene A-4 hydrolase OS=Rattus norvegicus GN=Lta4h PE=2 SV=2 27 487 5.0E-22
sp|Q6S9C8|LKHA4_CHILA Leukotriene A-4 hydrolase OS=Chinchilla lanigera GN=LTA4H PE=2 SV=3 33 487 8.0E-22
sp|P09960|LKHA4_HUMAN Leukotriene A-4 hydrolase OS=Homo sapiens GN=LTA4H PE=1 SV=2 27 487 1.0E-21
sp|Q3SZH7|LKHA4_BOVIN Leukotriene A-4 hydrolase OS=Bos taurus GN=LTA4H PE=2 SV=3 27 487 1.0E-21
sp|B7EA73|PSA_ORYSJ Puromycin-sensitive aminopeptidase OS=Oryza sativa subsp. japonica GN=Os08g0562700 PE=2 SV=1 124 528 2.0E-21
sp|P04825|AMPN_ECOLI Aminopeptidase N OS=Escherichia coli (strain K12) GN=pepN PE=1 SV=2 126 535 4.0E-21
sp|P19602|LKHA4_CAVPO Leukotriene A-4 hydrolase OS=Cavia porcellus GN=LTA4H PE=1 SV=3 27 487 3.0E-20
sp|Q8H0S9|PSA_ARATH Puromycin-sensitive aminopeptidase OS=Arabidopsis thaliana GN=MPA1 PE=2 SV=1 116 545 6.0E-20
sp|Q6C3E5|LKHA4_YARLI Leukotriene A-4 hydrolase homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0F00396g PE=3 SV=1 32 451 3.0E-19
sp|P45274|AMPN_HAEIN Aminopeptidase N OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=pepN PE=3 SV=1 69 513 1.0E-17
sp|A5DME6|LKA41_PICGU Leukotriene A-4 hydrolase homolog 1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PGUG_04447 PE=3 SV=2 54 482 2.0E-16
sp|P52922|LKHA4_DICDI Leukotriene A-4 hydrolase homolog OS=Dictyostelium discoideum GN=lkhA PE=2 SV=2 150 493 1.0E-15
sp|Q0U653|LKHA4_PHANO Leukotriene A-4 hydrolase homolog OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_12761 PE=3 SV=2 19 458 4.0E-15
sp|Q9FY49|LKHA4_ARATH Leukotriene A-4 hydrolase homolog OS=Arabidopsis thaliana GN=LKHA4 PE=2 SV=1 150 480 7.0E-15
sp|Q84TA3|LKHA4_ORYSJ Leukotriene A-4 hydrolase homolog OS=Oryza sativa subsp. japonica GN=LKHA4 PE=2 SV=1 150 480 9.0E-15
sp|A6RCT2|LKHA4_AJECN Leukotriene A-4 hydrolase homolog OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=HCAG_07440 PE=3 SV=2 11 458 1.0E-14
sp|Q59NB8|LKHA4_CANAL Leukotriene A-4 hydrolase homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LKH1 PE=3 SV=1 34 356 1.0E-13
sp|Q5B0W8|LKHA4_EMENI Leukotriene A-4 hydrolase homolog OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN5812 PE=3 SV=2 150 480 2.0E-13
sp|Q8VCT3|AMPB_MOUSE Aminopeptidase B OS=Mus musculus GN=Rnpep PE=1 SV=2 142 454 2.0E-13
sp|Q9H4A4|AMPB_HUMAN Aminopeptidase B OS=Homo sapiens GN=RNPEP PE=1 SV=2 142 454 2.0E-13
sp|Q4X265|LKHA4_ASPFU Leukotriene A-4 hydrolase homolog OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G07520 PE=3 SV=1 61 356 3.0E-13
sp|A1DG68|LKHA4_NEOFI Leukotriene A-4 hydrolase homolog OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_083260 PE=3 SV=1 61 356 7.0E-13
sp|O09175|AMPB_RAT Aminopeptidase B OS=Rattus norvegicus GN=Rnpep PE=1 SV=2 142 436 9.0E-13
sp|Q2GY21|LKHA4_CHAGB Leukotriene A-4 hydrolase homolog OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_07133 PE=3 SV=1 33 443 8.0E-12
sp|Q6FTM0|LKHA4_CANGA Leukotriene A-4 hydrolase homolog OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAGL0G01430g PE=3 SV=1 33 445 9.0E-12
sp|Q7S785|LKHA4_NEUCR Leukotriene A-4 hydrolase homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU06732 PE=3 SV=2 33 356 2.0E-11
sp|A5DSS4|LKHA4_LODEL Leukotriene A-4 hydrolase homolog OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=LELG_00410 PE=3 SV=2 42 356 5.0E-11
sp|A5DGF3|LKA42_PICGU Leukotriene A-4 hydrolase homolog 2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PGUG_02354 PE=3 SV=2 150 356 5.0E-11
sp|Q6CLD3|LKHA4_KLULA Leukotriene A-4 hydrolase homolog OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0F03883g PE=3 SV=1 150 460 5.0E-11
sp|A1CSI2|LKHA4_ASPCL Leukotriene A-4 hydrolase homolog OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_079530 PE=3 SV=1 61 443 5.0E-11
sp|Q1DVD1|LKHA4_COCIM Leukotriene A-4 hydrolase homolog OS=Coccidioides immitis (strain RS) GN=CIMG_05732 PE=3 SV=3 150 443 7.0E-11
sp|Q2TZ99|LKHA4_ASPOR Leukotriene A-4 hydrolase homolog OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090011000940 PE=3 SV=1 19 443 1.0E-10
sp|A7THG7|LKHA4_VANPO Leukotriene A-4 hydrolase homolog OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1039p41 PE=3 SV=1 150 445 1.0E-10
sp|A3LRX6|LKA41_PICST Leukotriene A-4 hydrolase homolog 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=LKA4 PE=3 SV=2 34 356 1.0E-10
sp|Q10740|LKHA4_YEAST Leukotriene A-4 hydrolase homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAP2 PE=1 SV=1 150 445 2.0E-10
sp|A6ZS33|LKHA4_YEAS7 Leukotriene A-4 hydrolase homolog OS=Saccharomyces cerevisiae (strain YJM789) GN=SCY_4744 PE=3 SV=1 150 445 2.0E-10
sp|A3LQI7|LKA42_PICST Leukotriene A-4 hydrolase homolog 2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=LTA4 PE=3 SV=2 44 451 3.0E-10
sp|Q6BW21|LKHA4_DEBHA Leukotriene A-4 hydrolase homolog OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2B14960g PE=3 SV=2 116 356 5.0E-10
sp|Q9HAU8|RNPL1_HUMAN Arginyl aminopeptidase-like 1 OS=Homo sapiens GN=RNPEPL1 PE=2 SV=2 210 454 6.0E-10
sp|A2QKF8|LKHA4_ASPNC Leukotriene A-4 hydrolase homolog OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An05g00070 PE=3 SV=2 117 441 2.0E-09
sp|Q0CFY9|LKHA4_ASPTN Leukotriene A-4 hydrolase homolog OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_06861 PE=3 SV=2 150 443 3.0E-09
sp|A4QUC1|LKHA4_MAGO7 Leukotriene A-4 hydrolase homolog OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_09481 PE=3 SV=2 33 356 1.0E-08
sp|A6SAG8|LKHA4_BOTFB Leukotriene A-4 hydrolase homolog OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_09514 PE=3 SV=2 33 356 2.0E-08
sp|A7EJL9|LKHA4_SCLS1 Leukotriene A-4 hydrolase homolog OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_05513 PE=3 SV=1 33 356 2.0E-08
sp|O94544|LKHA4_SCHPO Leukotriene A-4 hydrolase homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1322.05c PE=3 SV=1 150 356 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0008237 metallopeptidase activity Yes
GO:0046872 metal ion binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0070011 peptidase activity, acting on L-amino acid peptides No
GO:0008233 peptidase activity No
GO:0003824 catalytic activity No
GO:0046914 transition metal ion binding No
GO:0005488 binding No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9568
MCRGQAGVDVTGGGGASASPQDRELLPANVVPRHYHVTLEPDLEKLVFDGSVLIDLDVAQDSNCISLNTLELDIH
SAEVSCGGQTVSSSPRVSYDESKQVTKFDFDGRLAKGSQAQLEVKFTGQLNDKMAGFYRSTYKRDDGSEGILATT
QMEPTDARRAFPCFDEPALKAKFTVTLVADKHLTCLSNMDVASENEVPSQKTGTPKKAVRFNTSPLMSTYLVAFI
VGELNYVESRDFRVPVRVYAPPGQDIENGRFSLDLAVRTLKFYERVFGIDFPLPKMDQVAIPDFAQGAMENWGLI
TYRVVDLLLDDKASGAATKERVAEVVQHELAHQWFGNLVTMDWWEGLWLNEGFATWASWYSCNAFYPEWNVWQTY
VTDNLQSALALDSLRSSHPIEVPVKKADEINQIFDAISYSKGSCVLRMISTYLGEDTFLEGVRQYLKKHAYGNTQ
TGDLWASLSAASGKPVQEIMTAWTKKVGYPVVTVTEDDKAGTVHVKQNRFLRTGDTKPEEDKVLYPIFLSIRSKD
GVDKTVALNEREANLKLPSGDFFKLNANHTGIYRTSYTPARLEKLGKAARDGLLTVEDRAGMIADAGALATSGYQ
KTSGVLSLLKGFDAEAEFVVWNEIIGRLMTIQSAWVFEDAAVRDGLEAFLRDLVSPKAHKMGWKFSDSDGHVEQQ
FKAMMFEAAGLAGDKAIIDACKDMFGKFMGGDKSAVHPNIRKSVLGITLKYGGKEEYDKILDFYQASTSSDERNI
CLRTLGRAKDPELIKRTLGLLFGNEVKDQDVYMPVSGLRGHAAGIEAMFTWMTENWDKMYERLPPSLSMLGTMVS
IMTSGFTTQEQLSRVDKFFGDKSLSGYDQSLEQSKDSVRSKISWLGRDRQDVAAWLKANGYGG*
Coding >Hirsu2|9568
ATGTGCAGAGGCCAGGCCGGAGTCGACGTGACCGGCGGCGGCGGCGCCTCGGCGTCCCCCCAGGACCGCGAACTG
CTCCCCGCCAATGTCGTGCCGAGGCATTACCATGTTACGCTTGAGCCTGACCTCGAGAAGCTCGTCTTCGACGGC
TCTGTCCTCATCGACCTCGACGTCGCCCAAGATTCCAACTGCATCTCTCTCAACACCCTCGAACTCGATATCCAC
AGTGCCGAGGTGTCATGCGGCGGACAGACAGTCAGCTCCAGCCCTCGTGTCTCCTACGATGAATCGAAGCAGGTC
ACCAAGTTTGACTTCGACGGCCGCCTCGCCAAGGGAAGCCAGGCCCAGCTCGAGGTCAAATTCACCGGCCAGCTC
AACGACAAGATGGCCGGCTTCTATCGATCGACGTACAAGAGAGACGACGGCAGCGAGGGCATCCTTGCCACCACT
CAGATGGAGCCCACCGATGCCCGCCGAGCATTTCCCTGCTTCGATGAGCCCGCCCTCAAGGCCAAGTTCACCGTT
ACGCTCGTCGCCGACAAACACCTGACCTGTCTGAGCAACATGGATGTCGCCTCCGAAAACGAGGTCCCCTCCCAG
AAGACGGGCACCCCCAAAAAGGCCGTCCGCTTCAACACCTCGCCCCTCATGTCCACGTATCTCGTCGCCTTCATC
GTCGGTGAGCTCAACTACGTTGAGTCTCGTGACTTCCGCGTCCCCGTTCGTGTCTACGCCCCTCCCGGCCAGGAC
ATCGAAAATGGCCGCTTCTCCCTCGACTTGGCAGTCAGGACGCTCAAGTTCTACGAGCGCGTCTTCGGCATCGAC
TTTCCCCTCCCAAAGATGGACCAGGTCGCTATTCCCGACTTTGCTCAGGGAGCCATGGAGAATTGGGGCCTCATC
ACCTACCGCGTCGTCGACCTGCTTCTCGACGACAAGGCCAGCGGTGCTGCCACCAAGGAGCGCGTTGCCGAGGTC
GTACAGCACGAGTTGGCCCATCAGTGGTTCGGCAACCTGGTTACCATGGACTGGTGGGAGGGGCTCTGGCTCAAC
GAGGGTTTCGCTACCTGGGCTTCGTGGTACTCGTGCAACGCCTTCTACCCCGAGTGGAATGTCTGGCAGACGTAC
GTCACCGACAACCTGCAGTCTGCTCTAGCTTTGGACTCGTTGCGTAGCAGCCACCCGATCGAGGTGCCGGTCAAG
AAGGCCGACGAAATCAACCAGATTTTTGACGCCATTTCTTACTCCAAGGGATCCTGCGTTCTGCGCATGATCTCG
ACCTACCTCGGCGAGGACACCTTTCTGGAAGGCGTGCGGCAGTACCTCAAGAAGCACGCCTACGGCAACACTCAG
ACGGGAGACCTGTGGGCCTCGCTGAGCGCCGCTAGCGGCAAGCCGGTTCAGGAGATCATGACGGCCTGGACCAAG
AAGGTTGGCTACCCCGTCGTCACCGTCACCGAGGACGACAAGGCCGGCACGGTCCACGTCAAGCAAAACCGCTTT
CTCAGGACCGGCGACACGAAGCCCGAAGAGGACAAAGTCTTGTACCCCATCTTTCTCAGTATACGTTCCAAGGAT
GGCGTCGACAAAACGGTGGCGCTCAATGAGCGCGAAGCAAACCTCAAGTTGCCCAGCGGCGACTTCTTCAAGCTC
AACGCCAACCACACCGGCATCTACCGAACCTCGTACACCCCCGCCCGCCTGGAGAAGCTGGGCAAGGCGGCCCGA
GATGGTCTCTTGACGGTCGAGGACAGGGCCGGTATGATTGCCGATGCCGGCGCTTTGGCGACTTCGGGTTACCAG
AAGACGTCGGGTGTCCTGAGCCTGCTCAAGGGCTTCGACGCCGAGGCGGAATTCGTCGTCTGGAACGAGATCATC
GGTCGCCTGATGACCATCCAGAGCGCCTGGGTCTTTGAGGATGCGGCGGTCAGGGACGGCCTCGAGGCCTTCCTG
AGAGACCTTGTCAGCCCCAAGGCCCACAAGATGGGTTGGAAATTCTCCGACAGTGACGGCCACGTGGAACAACAG
TTCAAGGCCATGATGTTCGAGGCGGCTGGCCTCGCCGGCGACAAGGCCATCATCGACGCCTGCAAGGACATGTTT
GGCAAGTTCATGGGCGGAGATAAGTCGGCCGTTCATCCCAACATCAGGAAGAGCGTCTTGGGCATCACGCTCAAG
TACGGAGGCAAGGAAGAGTATGACAAGATTCTCGACTTCTACCAAGCGTCAACGAGCAGCGACGAGCGCAACATC
TGCCTACGCACACTGGGTCGCGCCAAGGACCCCGAACTGATCAAGCGGACCCTGGGCCTGCTCTTCGGAAACGAA
GTCAAGGACCAGGACGTCTACATGCCCGTCAGCGGGCTCCGTGGCCATGCAGCCGGCATTGAGGCCATGTTCACG
TGGATGACGGAGAACTGGGACAAGATGTACGAGAGGCTGCCGCCGAGCCTGTCCATGCTGGGCACCATGGTCAGC
ATCATGACCTCGGGCTTCACGACGCAGGAGCAGCTGTCCCGCGTGGACAAGTTCTTCGGCGACAAGAGCCTCAGT
GGCTACGACCAGTCGCTGGAGCAGAGCAAGGACTCAGTCCGGTCCAAGATTTCATGGCTGGGACGCGACCGCCAA
GACGTGGCAGCATGGCTCAAGGCCAATGGCTACGGCGGATGA
Transcript >Hirsu2|9568
ATGTGCAGAGGCCAGGCCGGAGTCGACGTGACCGGCGGCGGCGGCGCCTCGGCGTCCCCCCAGGACCGCGAACTG
CTCCCCGCCAATGTCGTGCCGAGGCATTACCATGTTACGCTTGAGCCTGACCTCGAGAAGCTCGTCTTCGACGGC
TCTGTCCTCATCGACCTCGACGTCGCCCAAGATTCCAACTGCATCTCTCTCAACACCCTCGAACTCGATATCCAC
AGTGCCGAGGTGTCATGCGGCGGACAGACAGTCAGCTCCAGCCCTCGTGTCTCCTACGATGAATCGAAGCAGGTC
ACCAAGTTTGACTTCGACGGCCGCCTCGCCAAGGGAAGCCAGGCCCAGCTCGAGGTCAAATTCACCGGCCAGCTC
AACGACAAGATGGCCGGCTTCTATCGATCGACGTACAAGAGAGACGACGGCAGCGAGGGCATCCTTGCCACCACT
CAGATGGAGCCCACCGATGCCCGCCGAGCATTTCCCTGCTTCGATGAGCCCGCCCTCAAGGCCAAGTTCACCGTT
ACGCTCGTCGCCGACAAACACCTGACCTGTCTGAGCAACATGGATGTCGCCTCCGAAAACGAGGTCCCCTCCCAG
AAGACGGGCACCCCCAAAAAGGCCGTCCGCTTCAACACCTCGCCCCTCATGTCCACGTATCTCGTCGCCTTCATC
GTCGGTGAGCTCAACTACGTTGAGTCTCGTGACTTCCGCGTCCCCGTTCGTGTCTACGCCCCTCCCGGCCAGGAC
ATCGAAAATGGCCGCTTCTCCCTCGACTTGGCAGTCAGGACGCTCAAGTTCTACGAGCGCGTCTTCGGCATCGAC
TTTCCCCTCCCAAAGATGGACCAGGTCGCTATTCCCGACTTTGCTCAGGGAGCCATGGAGAATTGGGGCCTCATC
ACCTACCGCGTCGTCGACCTGCTTCTCGACGACAAGGCCAGCGGTGCTGCCACCAAGGAGCGCGTTGCCGAGGTC
GTACAGCACGAGTTGGCCCATCAGTGGTTCGGCAACCTGGTTACCATGGACTGGTGGGAGGGGCTCTGGCTCAAC
GAGGGTTTCGCTACCTGGGCTTCGTGGTACTCGTGCAACGCCTTCTACCCCGAGTGGAATGTCTGGCAGACGTAC
GTCACCGACAACCTGCAGTCTGCTCTAGCTTTGGACTCGTTGCGTAGCAGCCACCCGATCGAGGTGCCGGTCAAG
AAGGCCGACGAAATCAACCAGATTTTTGACGCCATTTCTTACTCCAAGGGATCCTGCGTTCTGCGCATGATCTCG
ACCTACCTCGGCGAGGACACCTTTCTGGAAGGCGTGCGGCAGTACCTCAAGAAGCACGCCTACGGCAACACTCAG
ACGGGAGACCTGTGGGCCTCGCTGAGCGCCGCTAGCGGCAAGCCGGTTCAGGAGATCATGACGGCCTGGACCAAG
AAGGTTGGCTACCCCGTCGTCACCGTCACCGAGGACGACAAGGCCGGCACGGTCCACGTCAAGCAAAACCGCTTT
CTCAGGACCGGCGACACGAAGCCCGAAGAGGACAAAGTCTTGTACCCCATCTTTCTCAGTATACGTTCCAAGGAT
GGCGTCGACAAAACGGTGGCGCTCAATGAGCGCGAAGCAAACCTCAAGTTGCCCAGCGGCGACTTCTTCAAGCTC
AACGCCAACCACACCGGCATCTACCGAACCTCGTACACCCCCGCCCGCCTGGAGAAGCTGGGCAAGGCGGCCCGA
GATGGTCTCTTGACGGTCGAGGACAGGGCCGGTATGATTGCCGATGCCGGCGCTTTGGCGACTTCGGGTTACCAG
AAGACGTCGGGTGTCCTGAGCCTGCTCAAGGGCTTCGACGCCGAGGCGGAATTCGTCGTCTGGAACGAGATCATC
GGTCGCCTGATGACCATCCAGAGCGCCTGGGTCTTTGAGGATGCGGCGGTCAGGGACGGCCTCGAGGCCTTCCTG
AGAGACCTTGTCAGCCCCAAGGCCCACAAGATGGGTTGGAAATTCTCCGACAGTGACGGCCACGTGGAACAACAG
TTCAAGGCCATGATGTTCGAGGCGGCTGGCCTCGCCGGCGACAAGGCCATCATCGACGCCTGCAAGGACATGTTT
GGCAAGTTCATGGGCGGAGATAAGTCGGCCGTTCATCCCAACATCAGGAAGAGCGTCTTGGGCATCACGCTCAAG
TACGGAGGCAAGGAAGAGTATGACAAGATTCTCGACTTCTACCAAGCGTCAACGAGCAGCGACGAGCGCAACATC
TGCCTACGCACACTGGGTCGCGCCAAGGACCCCGAACTGATCAAGCGGACCCTGGGCCTGCTCTTCGGAAACGAA
GTCAAGGACCAGGACGTCTACATGCCCGTCAGCGGGCTCCGTGGCCATGCAGCCGGCATTGAGGCCATGTTCACG
TGGATGACGGAGAACTGGGACAAGATGTACGAGAGGCTGCCGCCGAGCCTGTCCATGCTGGGCACCATGGTCAGC
ATCATGACCTCGGGCTTCACGACGCAGGAGCAGCTGTCCCGCGTGGACAAGTTCTTCGGCGACAAGAGCCTCAGT
GGCTACGACCAGTCGCTGGAGCAGAGCAAGGACTCAGTCCGGTCCAAGATTTCATGGCTGGGACGCGACCGCCAA
GACGTGGCAGCATGGCTCAAGGCCAATGGCTACGGCGGATGA
Gene >Hirsu2|9568
ATGTGCAGAGGCCAGGCCGGAGTCGACGTGACCGGCGGCGGCGGCGCCTCGGCGTCCCCCCAGGACCGCGAACTG
CTCCCCGCCAATGTCGTGCCGAGGCATTACCATGTTACGCTTGAGCCTGACCTCGAGAAGCTCGTCTTCGACGGC
TCTGTCCTCATCGACCTCGACGTCGCCCAAGATTCCAACTGCATCTCTCTCAACACCCTCGAACTCGATATCCAC
AGTGCCGAGGTGTCATGCGGCGGACAGACAGTCAGGTATATTACAGCGACGATGCCATTGCCCCGCGCCCCGGGC
CCCCACCTCTGCTGACCTTGATGCCTCCCTCTCCAGCTCCAGCCCTCGTGTCTCCTACGATGAATCGAAGCAGGT
CACCAAGTTTGACTTCGACGGCCGCCTCGCCAAGGGAAGCCAGGCCCAGCTCGAGGTCAAATTCACCGGCCAGCT
CAACGACAAGATGGCCGGCTTCTATCGATCGACGTACAAGAGAGACGACGGCAGCGAGGGCATCCTTGCCACCAC
TCAGATGGAGCCCACCGATGCCCGCCGAGCATTTCCCTGCTTCGATGAGCCCGCCCTCAAGGCCAAGTTCACCGT
TACGCTCGTCGCCGACAAACACCTGACCTGTCTGAGCAACATGGATGTCGCCTCCGAAAACGAGGTCCCCTCCCA
GAAGACGGGCACCCCCAAAAAGGCCGTCCGCTTCAACACCTCGCCCCTCATGTCCACGTATCTCGTCGCCTTCAT
CGTCGGTGAGCTCAACTACGTTGAGTCTCGTGACTTCCGCGTCCCCGTTCGTGTCTACGCCCCTCCCGGCCAGGA
CATCGAAAATGGCCGCTTCTCCCTCGACTTGGCAGTCAGGACGCTCAAGTTCTACGAGCGCGTCTTCGGCATCGA
CTTTCCCCTCCCAAAGATGGACCAGGTCGCTATTCCCGACTTTGCTCAGGGAGCCATGGAGAATTGGGGCCTCAT
CACCTACCGCGTCGTCGACCTGCTTCTCGACGACAAGGCCAGCGGTGCTGCCACCAAGGAGCGCGTTGCCGAGGT
CGTACAGCACGAGTTGGCCCATCAGTGGTTCGGCAACCTGGTTACCATGGACTGGTGGGAGGGGCTCTGGCTCAA
CGAGGGTTTCGCTACCTGGGCTTCGTGGGTGAGTCGAAATCCAGAGACACGCCTGCCACTCCTTCTAGGCGACGC
TGACACCCGCTCGACCCCCAGTACTCGTGCAACGCCTTCTACCCCGAGTGGAATGTCTGGCAGACGTACGTCACC
GACAACCTGCAGTCTGCTCTAGCTTTGGACTCGTTGCGTAGCAGCCACCCGATCGAGGTGCCGGTCAAGAAGGCC
GACGAAATCAACCAGATTTTTGACGCCATTTCTTACTCCAAGGGATCCTGCGTTCTGCGCATGATCTCGACCTAC
CTCGGCGAGGACACCTTTCTGGAAGGCGTGCGGCAGTACCTCAAGAAGCACGCCTACGGCAACACTCAGACGGGA
GACCTGTGGGCCTCGCTGAGCGCCGCTAGCGGCAAGCCGGTTCAGGAGATCATGACGGCCTGGACCAAGAAGGTT
GGCTACCCCGTCGTCACCGTCACCGAGGACGACAAGGCCGGCACGGTCCACGTCAAGCAAAACCGCTTTCTCAGG
ACCGGCGACACGAAGCCCGAAGAGGACAAAGTCTTGTACCCCATCTTTCTCAGTATACGTTCCAAGGATGGCGTC
GACAAAACGGTGGCGCTCAATGAGCGCGAAGCAAACCTCAAGTTGCCCAGCGGCGACTTCTTCAAGCTCAACGCC
AACCACACCGGCATCTACCGAACCTCGTACACCCCCGCCCGCCTGGAGAAGCTGGGCAAGGCGGCCCGAGATGGT
CTCTTGACGGTCGAGGACAGGGCCGGTATGATTGCCGATGCCGGCGCTTTGGCGACTTCGGGTTACCAGAAGACG
TCGGGTGTCCTGAGCCTGCTCAAGGGCTTCGACGCCGAGGCGGAATTCGTCGTCTGGAACGAGATCATCGGTCGC
CTGATGACCATCCAGAGCGCCTGGGTCTTTGAGGATGCGGCGGTCAGGGACGGCCTCGAGGCCTTCCTGAGAGAC
CTTGTCAGCCCCAAGGCCCACAAGATGGGTTGGAAATTCTCCGACAGTGACGGCCACGTGGAACAACAGTTCAAG
GCCATGATGTTCGAGGCGGCTGGCCTCGCCGGCGACAAGGCCATCATCGACGCCTGCAAGGACATGTTTGGCAAG
TTCATGGGCGGAGATAAGTCGGCCGTTCATCCCAACATCAGGAAGAGCGTCTTGGGCATCACGCTCAAGTACGGA
GGCAAGGAAGAGGTATGGCCCAGACCCAGTTGCTTCTCTTTTTCTGTTCGTCCCGATGCTCGGCCCCGGAGCACG
GAATGCTGACCAGCCGTACAGTATGACAAGATTCTCGACTTCTACCAAGCGTCAACGAGCAGCGACGAGCGCAAC
ATCTGCCTACGCACACTGGGTCGCGCCAAGGACCCCGAACTGATCAAGCGGACCCTGGGCCTGCTCTTCGGAAAC
GAAGTCAAGGACCAGGACGTCTACATGCCCGTCAGCGGGCTCCGTGGCCATGCAGCCGGCATTGAGGCCATGTTC
ACGTGGATGACGGAGAACTGGGACAAGATGTACGAGAGGCTGCCGCCGAGCCTGTCCATGCTGGGCACCATGGTC
AGCATCATGACCTCGGGCTTCACGACGCAGGAGCAGCTGTCCCGCGTGGACAAGTTCTTCGGCGACAAGAGCCTC
AGTGGCTACGACCAGTCGCTGGAGCAGAGCAAGGACTCAGTCCGGTCCAAGATTTCATGGCTGGGACGCGACCGC
CAAGACGTGGCAGCATGGCTCAAGGCCAATGGCTACGGCGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail