Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9565
Gene name
LocationContig_700:2952..4184
Strand-
Gene length (bp)1232
Transcript length (bp)924
Coding sequence length (bp)924
Protein length (aa) 308

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05368 NmrA NmrA-like family 3.6E-57 6 242
PF13460 NAD_binding_10 NAD(P)H-binding 1.2E-20 9 161

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5ZID0|NMRL1_CHICK NmrA-like family domain-containing protein 1 OS=Gallus gallus GN=NMRAL1 PE=2 SV=1 3 259 5.0E-38
sp|Q0VCN1|NMRL1_BOVIN NmrA-like family domain-containing protein 1 OS=Bos taurus GN=NMRAL1 PE=2 SV=1 3 259 8.0E-36
sp|Q9HBL8|NMRL1_HUMAN NmrA-like family domain-containing protein 1 OS=Homo sapiens GN=NMRAL1 PE=1 SV=1 3 221 9.0E-33
sp|Q8K2T1|NMRL1_MOUSE NmrA-like family domain-containing protein 1 OS=Mus musculus GN=Nmral1 PE=1 SV=1 3 239 3.0E-32
sp|Q54LJ8|NMRL1_DICDI NmrA-like family domain-containing protein DDB_G0286605 OS=Dictyostelium discoideum GN=DDB_G0286605 PE=2 SV=1 1 300 5.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5ZID0|NMRL1_CHICK NmrA-like family domain-containing protein 1 OS=Gallus gallus GN=NMRAL1 PE=2 SV=1 3 259 5.0E-38
sp|Q0VCN1|NMRL1_BOVIN NmrA-like family domain-containing protein 1 OS=Bos taurus GN=NMRAL1 PE=2 SV=1 3 259 8.0E-36
sp|Q9HBL8|NMRL1_HUMAN NmrA-like family domain-containing protein 1 OS=Homo sapiens GN=NMRAL1 PE=1 SV=1 3 221 9.0E-33
sp|Q8K2T1|NMRL1_MOUSE NmrA-like family domain-containing protein 1 OS=Mus musculus GN=Nmral1 PE=1 SV=1 3 239 3.0E-32
sp|Q54LJ8|NMRL1_DICDI NmrA-like family domain-containing protein DDB_G0286605 OS=Dictyostelium discoideum GN=DDB_G0286605 PE=2 SV=1 1 300 5.0E-19
sp|P23762|NMR1_NEUCR Nitrogen metabolite repression protein nmr OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmr PE=1 SV=2 72 242 6.0E-15
sp|Q8KU07|AZOB_XENAZ NAD(P)H azoreductase OS=Xenophilus azovorans GN=azoB PE=1 SV=2 4 181 2.0E-11
sp|Q5AU62|NMRA_EMENI Nitrogen metabolite repression protein nmrA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nmrA PE=1 SV=1 3 239 3.0E-10
sp|P48279|YCF39_CYAPA Uncharacterized protein ycf39 OS=Cyanophora paradoxa GN=ycf39 PE=3 SV=1 5 201 1.0E-08
sp|P49534|YCF39_ODOSI Uncharacterized protein ycf39 OS=Odontella sinensis GN=ycf39 PE=3 SV=1 5 246 4.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9565
MSKILTVFGATGNQGGSVVKAVLADAALSKQFKIRGITRDATRPSAKALAEKGVELVKADMSSVEAAAPAVKGAH
TVFLVTNYWESMSADKEEAQGRAVTDACKAAGVKHLIFSSLINTAEASKGKLKHIVHFDSKSRIEDYIRASGVPA
TFVLPGFFMSNFGEFIRKQDDGSYSMPVPEGVTLDNAKIPLFDAVADNGKFVKAAVKHFPSTDGKRIYAATDYYS
PSRLISEFGTAMGKPAKAQPVSQDTFKSFMPPAAGQELLENWLLLESPGYYGGADLAESLALLDEKPTSWKEFVE
SNKATWE*
Coding >Hirsu2|9565
ATGTCCAAGATCCTCACCGTCTTCGGCGCCACCGGCAACCAGGGCGGCTCCGTCGTCAAGGCCGTCCTGGCCGAC
GCCGCCCTGTCCAAGCAGTTCAAGATCCGCGGCATCACGCGGGATGCGACCAGGCCCTCGGCCAAAGCGCTCGCC
GAGAAAGGTGTTGAGCTTGTCAAGGCAGACATGTCGAGCGTCGAGGCCGCCGCGCCGGCCGTCAAGGGCGCCCAC
ACCGTCTTCCTCGTCACCAACTACTGGGAGAGCATGTCGGCCGACAAGGAGGAGGCGCAGGGCCGGGCCGTGACG
GACGCCTGCAAGGCGGCCGGCGTCAAGCACCTCATCTTCTCCTCCCTCATCAACACGGCCGAGGCCAGTAAGGGC
AAGCTGAAGCACATCGTCCACTTCGACAGCAAGTCCCGGATCGAGGACTACATCCGCGCCAGCGGCGTCCCGGCC
ACCTTTGTCCTCCCGGGCTTCTTTATGTCCAACTTTGGCGAGTTCATCCGCAAGCAGGACGACGGCAGCTACTCG
ATGCCTGTCCCGGAGGGGGTGACGCTCGACAACGCCAAGATTCCGCTCTTCGACGCCGTCGCCGACAATGGCAAG
TTCGTCAAGGCGGCCGTCAAGCACTTCCCGTCCACCGACGGCAAGCGCATCTACGCCGCCACCGACTACTACAGC
CCGTCCCGGCTCATCTCCGAGTTCGGTACCGCCATGGGCAAGCCGGCCAAGGCGCAGCCCGTCTCGCAGGACACC
TTCAAGTCCTTCATGCCGCCCGCGGCCGGTCAGGAGTTGCTGGAGAACTGGCTGCTGCTCGAGAGCCCGGGCTAC
TACGGGGGCGCCGACCTGGCCGAGAGTCTGGCCCTGCTGGACGAGAAGCCGACGAGCTGGAAGGAATTTGTCGAG
TCGAACAAGGCCACATGGGAATAG
Transcript >Hirsu2|9565
ATGTCCAAGATCCTCACCGTCTTCGGCGCCACCGGCAACCAGGGCGGCTCCGTCGTCAAGGCCGTCCTGGCCGAC
GCCGCCCTGTCCAAGCAGTTCAAGATCCGCGGCATCACGCGGGATGCGACCAGGCCCTCGGCCAAAGCGCTCGCC
GAGAAAGGTGTTGAGCTTGTCAAGGCAGACATGTCGAGCGTCGAGGCCGCCGCGCCGGCCGTCAAGGGCGCCCAC
ACCGTCTTCCTCGTCACCAACTACTGGGAGAGCATGTCGGCCGACAAGGAGGAGGCGCAGGGCCGGGCCGTGACG
GACGCCTGCAAGGCGGCCGGCGTCAAGCACCTCATCTTCTCCTCCCTCATCAACACGGCCGAGGCCAGTAAGGGC
AAGCTGAAGCACATCGTCCACTTCGACAGCAAGTCCCGGATCGAGGACTACATCCGCGCCAGCGGCGTCCCGGCC
ACCTTTGTCCTCCCGGGCTTCTTTATGTCCAACTTTGGCGAGTTCATCCGCAAGCAGGACGACGGCAGCTACTCG
ATGCCTGTCCCGGAGGGGGTGACGCTCGACAACGCCAAGATTCCGCTCTTCGACGCCGTCGCCGACAATGGCAAG
TTCGTCAAGGCGGCCGTCAAGCACTTCCCGTCCACCGACGGCAAGCGCATCTACGCCGCCACCGACTACTACAGC
CCGTCCCGGCTCATCTCCGAGTTCGGTACCGCCATGGGCAAGCCGGCCAAGGCGCAGCCCGTCTCGCAGGACACC
TTCAAGTCCTTCATGCCGCCCGCGGCCGGTCAGGAGTTGCTGGAGAACTGGCTGCTGCTCGAGAGCCCGGGCTAC
TACGGGGGCGCCGACCTGGCCGAGAGTCTGGCCCTGCTGGACGAGAAGCCGACGAGCTGGAAGGAATTTGTCGAG
TCGAACAAGGCCACATGGGAATAG
Gene >Hirsu2|9565
ATGTCCAAGATCCTCACCGTCTTCGGCGCCACCGGCAACCAGGGCGGCTCCGTCGTCAAGGCCGTCCTGGCCGAC
GCCGCCCTGTCCAAGCAGTTCAAGATCCGCGGCATCACGCGGGATGCGACCAGGCCCTCGGCCAAAGCGCTCGCC
GAGAAAGGTGTTGAGCTTGTCAAGGTACGCCTGTGCTCCGGTCCCGCGCCGTTGGTTCACCTTCTCCATCTTGTT
CCCACACCTCGAGAAACAATCTGGGAGATGCTTGAAGCCGAGATGCAGACATCGATCCTCGGGAGCTTGAGAGGA
CGACGGCTGACAGCTGAGAACCGCAGGCAGACATGTCGAGCGTCGAGGCCGCCGCGCCGGCCGTCAAGGGCGCCC
ACACCGTCTTCCTCGTCACCAACTACTGGGAGAGCATGTCGGCCGACAAGGAGGAGGCGCAGGGCCGGGCCGTGA
CGGACGCCTGCAAGGCGGCCGGCGTCAAGCACCTCATCTTCTCCTCCCTCATCAACACGGCCGAGGCCAGTAAGG
GCAAGCTGAAGCACATCGTCCACTTCGACAGCAAGTCCCGGATCGAGGACTACATCCGCGCCAGCGGCGTCCCGG
CCACCTTTGTCCTCCCGGGCTTCTTTATGTCCAACTTTGGCGAGTTCATCCGCAAGCAGGACGACGGCAGCTACT
CGATGCCTGTCCCGGAGGGGGTGACGCTCGACAACGCCAAGATTCCGCTCTTCGACGCCGTCGCCGACAATGGTA
CGTTGCGGGACTCCCTGTTTTTGCTTTATTTTCGGTTCGAAGCCTCACGTCGTCCTGTGCCCTTGTACATTGAAC
CCCCTTTCCCCACAGCTTCAAGATATGGTTCGCGGGAAAAAATGAGCGCGTGCTGAAGGACCCTCTGGTGTTCTA
TAGGCAAGTTCGTCAAGGCGGCCGTCAAGCACTTCCCGTCCACCGACGGCAAGCGCATCTACGCCGCCACCGACT
ACTACAGCCCGTCCCGGCTCATCTCCGAGTTCGGTACCGCCATGGGCAAGCCGGCCAAGGCGCAGCCCGTCTCGC
AGGACACCTTCAAGTCCTTCATGCCGCCCGCGGCCGGTCAGGAGTTGCTGGAGAACTGGCTGCTGCTCGAGAGCC
CGGGCTACTACGGGGGCGCCGACCTGGCCGAGAGTCTGGCCCTGCTGGACGAGAAGCCGACGAGCTGGAAGGAAT
TTGTCGAGTCGAACAAGGCCACATGGGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail