Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9564
Gene name
LocationContig_700:36..1503
Strand+
Gene length (bp)1467
Transcript length (bp)1467
Coding sequence length (bp)1467
Protein length (aa) 489

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 5.9E-35 53 432

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 20 483 2.0E-135
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 12 480 1.0E-119
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 12 480 4.0E-119
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 30 480 8.0E-119
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 16 480 2.0E-114
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 20 483 2.0E-135
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 12 480 1.0E-119
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 12 480 4.0E-119
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 30 480 8.0E-119
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 16 480 2.0E-114
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 20 480 8.0E-108
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 16 485 1.0E-88
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 23 480 2.0E-77
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 3 480 2.0E-77
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 24 479 2.0E-75
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 13 482 9.0E-73
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 23 482 5.0E-68
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 13 483 1.0E-67
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 21 480 3.0E-65
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 31 477 6.0E-64
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 23 483 8.0E-64
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 23 483 9.0E-64
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 27 482 1.0E-63
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 31 477 2.0E-63
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 1 453 4.0E-59
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 24 483 1.0E-58
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 10 477 6.0E-49
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 10 477 3.0E-48
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 24 477 1.0E-46
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 24 486 1.0E-45
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 22 480 1.0E-41
sp|O59833|YCUD_SCHPO Uncharacterized transporter C965.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.13 PE=3 SV=1 30 480 1.0E-34
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 28 486 1.0E-32
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 37 244 3.0E-17
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 71 448 1.0E-13
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 37 271 2.0E-12
sp|G2TRN8|YI74_SCHPO Putative uncharacterized transporter C977.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.04 PE=5 SV=1 335 477 5.0E-11
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 4 225 3.0E-08
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 32 226 6.0E-08
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 334 457 8.0E-08
sp|P45123|BCR_HAEIN Bicyclomycin resistance protein homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bcr PE=3 SV=1 41 253 3.0E-07
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 352 448 7.0E-07
sp|P28246|BCR_ECOLI Bicyclomycin resistance protein OS=Escherichia coli (strain K12) GN=bcr PE=1 SV=4 51 265 1.0E-06
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 29 257 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

Domain # Start End Length
1 44 66 22
2 79 101 22
3 111 130 19
4 137 159 22
5 169 191 22
6 280 302 22
7 312 334 22
8 355 377 22
9 387 409 22
10 416 438 22
11 453 472 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9564
MRSRGAPAFTHPLAHVPTTADQLVDFDSADDPYHPLNWPTRKKVLTTLMYGLVTMTATWASSSYSAGTRDIAREF
GVGIQVANLGTSLFLLGFGLGPLLWAPLSEVYGRRLAVMAPMFVAACFSFGSAVAKDLQTLMITRFFGAFFASAP
VTNTGGVLGDLYSPAWRGIAMAGYAMSVVGGPVIGPIVSAALVQDRSLGWRWTQYVTGILQASLLLLAILLIDES
YPPKLLVYKARRLRLQSGNWALHAKFEEWDVSVGQLARKFLVRPVQLLCTPICFLIALYASFCYGILYMQLGAIP
IIFGELRGWKPLVAELPFLCIMIGAILGCGLNVYNQILYNKAYHAAGDRPVPERRLPPMMLGSVLFSGGQFFVGW
TATPSVHWIAPCIGLVMLGIGFFTIFQAALNYLVDTFQAYAASAVAANTFLRSCFAAAFPLVVGPLYHNIGVGPG
SSITGGFAALLIPVPFIFYLFGKRVRRASKWSKASVFD*
Coding >Hirsu2|9564
ATGCGCTCGCGCGGCGCCCCGGCCTTCACGCACCCGCTGGCGCACGTGCCGACGACGGCCGACCAGCTCGTCGAC
TTCGACTCGGCCGACGACCCCTACCACCCGCTCAACTGGCCGACGCGCAAGAAGGTGCTGACGACGCTCATGTAC
GGCCTCGTCACCATGACGGCCACCTGGGCCTCGTCGTCGTACTCGGCCGGCACGCGCGACATCGCGCGCGAGTTC
GGCGTCGGCATCCAGGTCGCCAACCTCGGCACCTCGCTCTTCCTGCTCGGCTTCGGCCTCGGCCCGCTGCTGTGG
GCGCCGCTGAGCGAGGTCTACGGCCGCCGCCTGGCCGTCATGGCCCCCATGTTCGTCGCCGCCTGCTTCAGCTTC
GGCTCCGCCGTCGCCAAGGACCTGCAGACGCTCATGATCACCCGCTTCTTCGGCGCCTTCTTCGCCTCCGCCCCC
GTCACCAACACCGGCGGCGTCCTCGGCGACCTGTACTCGCCCGCCTGGCGCGGCATCGCCATGGCCGGCTACGCC
ATGTCCGTCGTCGGTGGGCCCGTCATCGGCCCCATCGTCTCGGCCGCCCTCGTCCAGGACCGCTCGCTCGGCTGG
CGTTGGACCCAGTACGTGACCGGCATCCTGCAGGCCAGCCTGCTGCTCCTCGCCATCCTCCTCATCGACGAGAGC
TACCCGCCCAAGCTGCTCGTCTACAAGGCCCGCCGCCTCCGCCTGCAGTCGGGCAACTGGGCCCTGCACGCCAAG
TTCGAGGAGTGGGACGTCAGCGTCGGCCAGCTCGCCCGCAAGTTCCTCGTGCGCCCCGTCCAGCTGCTCTGCACG
CCCATCTGCTTCCTCATCGCCCTCTACGCCAGCTTCTGCTACGGCATTCTGTACATGCAGCTGGGCGCCATCCCC
ATCATCTTCGGCGAGCTCCGCGGCTGGAAGCCGCTGGTAGCCGAGCTTCCCTTCCTGTGCATCATGATCGGCGCC
ATCCTCGGCTGCGGCCTCAACGTCTACAACCAGATTCTGTACAACAAGGCCTACCACGCCGCCGGCGACCGGCCT
GTGCCGGAGCGCCGGCTGCCGCCCATGATGCTCGGCTCCGTGCTCTTCAGCGGCGGTCAGTTCTTCGTCGGCTGG
ACGGCCACCCCCAGCGTCCACTGGATCGCGCCCTGCATCGGCCTCGTCATGCTTGGCATCGGCTTCTTCACCATC
TTCCAGGCCGCTCTCAACTACCTCGTCGACACCTTCCAGGCCTATGCGGCCTCCGCCGTCGCTGCCAACACCTTC
CTGCGCTCCTGTTTCGCCGCCGCCTTCCCGCTCGTCGTCGGCCCGCTCTACCACAACATCGGTGTCGGGCCAGGC
TCCAGCATCACCGGCGGCTTCGCCGCGCTGCTGATCCCGGTACCTTTCATCTTTTACCTGTTCGGCAAGCGGGTT
CGGAGGGCGTCCAAGTGGTCCAAGGCGTCCGTCTTCGACTGA
Transcript >Hirsu2|9564
ATGCGCTCGCGCGGCGCCCCGGCCTTCACGCACCCGCTGGCGCACGTGCCGACGACGGCCGACCAGCTCGTCGAC
TTCGACTCGGCCGACGACCCCTACCACCCGCTCAACTGGCCGACGCGCAAGAAGGTGCTGACGACGCTCATGTAC
GGCCTCGTCACCATGACGGCCACCTGGGCCTCGTCGTCGTACTCGGCCGGCACGCGCGACATCGCGCGCGAGTTC
GGCGTCGGCATCCAGGTCGCCAACCTCGGCACCTCGCTCTTCCTGCTCGGCTTCGGCCTCGGCCCGCTGCTGTGG
GCGCCGCTGAGCGAGGTCTACGGCCGCCGCCTGGCCGTCATGGCCCCCATGTTCGTCGCCGCCTGCTTCAGCTTC
GGCTCCGCCGTCGCCAAGGACCTGCAGACGCTCATGATCACCCGCTTCTTCGGCGCCTTCTTCGCCTCCGCCCCC
GTCACCAACACCGGCGGCGTCCTCGGCGACCTGTACTCGCCCGCCTGGCGCGGCATCGCCATGGCCGGCTACGCC
ATGTCCGTCGTCGGTGGGCCCGTCATCGGCCCCATCGTCTCGGCCGCCCTCGTCCAGGACCGCTCGCTCGGCTGG
CGTTGGACCCAGTACGTGACCGGCATCCTGCAGGCCAGCCTGCTGCTCCTCGCCATCCTCCTCATCGACGAGAGC
TACCCGCCCAAGCTGCTCGTCTACAAGGCCCGCCGCCTCCGCCTGCAGTCGGGCAACTGGGCCCTGCACGCCAAG
TTCGAGGAGTGGGACGTCAGCGTCGGCCAGCTCGCCCGCAAGTTCCTCGTGCGCCCCGTCCAGCTGCTCTGCACG
CCCATCTGCTTCCTCATCGCCCTCTACGCCAGCTTCTGCTACGGCATTCTGTACATGCAGCTGGGCGCCATCCCC
ATCATCTTCGGCGAGCTCCGCGGCTGGAAGCCGCTGGTAGCCGAGCTTCCCTTCCTGTGCATCATGATCGGCGCC
ATCCTCGGCTGCGGCCTCAACGTCTACAACCAGATTCTGTACAACAAGGCCTACCACGCCGCCGGCGACCGGCCT
GTGCCGGAGCGCCGGCTGCCGCCCATGATGCTCGGCTCCGTGCTCTTCAGCGGCGGTCAGTTCTTCGTCGGCTGG
ACGGCCACCCCCAGCGTCCACTGGATCGCGCCCTGCATCGGCCTCGTCATGCTTGGCATCGGCTTCTTCACCATC
TTCCAGGCCGCTCTCAACTACCTCGTCGACACCTTCCAGGCCTATGCGGCCTCCGCCGTCGCTGCCAACACCTTC
CTGCGCTCCTGTTTCGCCGCCGCCTTCCCGCTCGTCGTCGGCCCGCTCTACCACAACATCGGTGTCGGGCCAGGC
TCCAGCATCACCGGCGGCTTCGCCGCGCTGCTGATCCCGGTACCTTTCATCTTTTACCTGTTCGGCAAGCGGGTT
CGGAGGGCGTCCAAGTGGTCCAAGGCGTCCGTCTTCGACTGA
Gene >Hirsu2|9564
ATGCGCTCGCGCGGCGCCCCGGCCTTCACGCACCCGCTGGCGCACGTGCCGACGACGGCCGACCAGCTCGTCGAC
TTCGACTCGGCCGACGACCCCTACCACCCGCTCAACTGGCCGACGCGCAAGAAGGTGCTGACGACGCTCATGTAC
GGCCTCGTCACCATGACGGCCACCTGGGCCTCGTCGTCGTACTCGGCCGGCACGCGCGACATCGCGCGCGAGTTC
GGCGTCGGCATCCAGGTCGCCAACCTCGGCACCTCGCTCTTCCTGCTCGGCTTCGGCCTCGGCCCGCTGCTGTGG
GCGCCGCTGAGCGAGGTCTACGGCCGCCGCCTGGCCGTCATGGCCCCCATGTTCGTCGCCGCCTGCTTCAGCTTC
GGCTCCGCCGTCGCCAAGGACCTGCAGACGCTCATGATCACCCGCTTCTTCGGCGCCTTCTTCGCCTCCGCCCCC
GTCACCAACACCGGCGGCGTCCTCGGCGACCTGTACTCGCCCGCCTGGCGCGGCATCGCCATGGCCGGCTACGCC
ATGTCCGTCGTCGGTGGGCCCGTCATCGGCCCCATCGTCTCGGCCGCCCTCGTCCAGGACCGCTCGCTCGGCTGG
CGTTGGACCCAGTACGTGACCGGCATCCTGCAGGCCAGCCTGCTGCTCCTCGCCATCCTCCTCATCGACGAGAGC
TACCCGCCCAAGCTGCTCGTCTACAAGGCCCGCCGCCTCCGCCTGCAGTCGGGCAACTGGGCCCTGCACGCCAAG
TTCGAGGAGTGGGACGTCAGCGTCGGCCAGCTCGCCCGCAAGTTCCTCGTGCGCCCCGTCCAGCTGCTCTGCACG
CCCATCTGCTTCCTCATCGCCCTCTACGCCAGCTTCTGCTACGGCATTCTGTACATGCAGCTGGGCGCCATCCCC
ATCATCTTCGGCGAGCTCCGCGGCTGGAAGCCGCTGGTAGCCGAGCTTCCCTTCCTGTGCATCATGATCGGCGCC
ATCCTCGGCTGCGGCCTCAACGTCTACAACCAGATTCTGTACAACAAGGCCTACCACGCCGCCGGCGACCGGCCT
GTGCCGGAGCGCCGGCTGCCGCCCATGATGCTCGGCTCCGTGCTCTTCAGCGGCGGTCAGTTCTTCGTCGGCTGG
ACGGCCACCCCCAGCGTCCACTGGATCGCGCCCTGCATCGGCCTCGTCATGCTTGGCATCGGCTTCTTCACCATC
TTCCAGGCCGCTCTCAACTACCTCGTCGACACCTTCCAGGCCTATGCGGCCTCCGCCGTCGCTGCCAACACCTTC
CTGCGCTCCTGTTTCGCCGCCGCCTTCCCGCTCGTCGTCGGCCCGCTCTACCACAACATCGGTGTCGGGCCAGGC
TCCAGCATCACCGGCGGCTTCGCCGCGCTGCTGATCCCGGTACCTTTCATCTTTTACCTGTTCGGCAAGCGGGTT
CGGAGGGCGTCCAAGTGGTCCAAGGCGTCCGTCTTCGACTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail