Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|955
Gene name
LocationContig_12:35658..38218
Strand+
Gene length (bp)2560
Transcript length (bp)2427
Coding sequence length (bp)2427
Protein length (aa) 809

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 8.3E-14 601 699
PF06985 HET Heterokaryon incompatibility protein (HET) 1.1E-10 22 108
PF13606 Ank_3 Ankyrin repeat 1.1E-03 636 660
PF13606 Ank_3 Ankyrin repeat 1.4E-04 670 698
PF00023 Ank Ankyrin repeat 2.6E-03 636 667
PF00023 Ank Ankyrin repeat 4.3E-03 670 697
PF13637 Ank_4 Ankyrin repeats (many copies) 4.0E-08 638 690

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 18 239 6.0E-61
sp|Q502M6|ANR29_DANRE Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 630 704 1.0E-06
sp|Q00PJ3|ASZ1_ATEAB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Atelerix albiventris GN=ASZ1 PE=3 SV=1 592 713 1.0E-06
sp|Q8ZWC4|Y1861_PYRAE Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 640 703 1.0E-06
sp|Q9P0K7|RAI14_HUMAN Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 636 735 1.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 18 239 6.0E-61
sp|Q502M6|ANR29_DANRE Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 630 704 1.0E-06
sp|Q00PJ3|ASZ1_ATEAB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Atelerix albiventris GN=ASZ1 PE=3 SV=1 592 713 1.0E-06
sp|Q8ZWC4|Y1861_PYRAE Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 640 703 1.0E-06
sp|Q9P0K7|RAI14_HUMAN Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 636 735 1.0E-06
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 654 702 1.0E-06
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 630 706 3.0E-06
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 630 706 4.0E-06
sp|A4D7T3|ASZ1_MACEU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Macropus eugenii GN=ASZ1 PE=3 SV=1 634 713 6.0E-06
sp|Q09YJ5|ASZ1_MUNMU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Muntiacus muntjak GN=ASZ1 PE=3 SV=1 634 716 8.0E-06
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 614 697 8.0E-06
sp|Q09YI3|ASZ1_SHEEP Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ovis aries GN=ASZ1 PE=3 SV=1 634 716 8.0E-06
sp|Q8WMX8|ASZ1_BOVIN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Bos taurus GN=ASZ1 PE=2 SV=1 634 716 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|955
MRLISTATFKVEEFLNDELPPYAILSHTWGEDEEEVTLRDIQNGAFNKLGNGYIKLQGCCEQAKKNGLRYAWIDT
CCINKESSSEIEEAINSMFQWYSKASVCYAFLSDVFPGDTPGSEASKFSSSRWFGRGWTLQELLAPTKLCFYDQN
WTLLGTKTSLSAVVEDITGIPRPFLLGSVPLSEASVAQRMSWAAKRRTKRREDIAYCLLGIFRVNMPMIYGEGDD
AFRRLQEAIMKNTGDESILAWGFSPQSSLPSRTTNVVSRGVLATSPADFANCQTIVTREFGKSLLNTFEISAGHL
RAHLSLHTTSAGDRYGLLNCGHRDQPEHIVGVPLASAEHREPSNSSCLIRPQGCPSILFSRTASRTPPTAVYVRT
ERPDTATDRRYWFYIDDSKTDLKLIDVYPRFRWKEEWAMIATTYSPDSSTCVLQRSLARFRTRDRECRDVIVVLE
FQAQQLQRSARYHVMTCSGNLNLADLSKRFVFMDNKMFGKQGASYGRRNLSVTVKEELIGKHPRFVVRLATVSTV
PEITVDATRELRLLGLRQDLVRVWHQEERMRPEVERVCQDKMETMAAMASWRKRLGLIEEELKGLIKERIFLSGA
AARSGEMLQTMLDTDTIDVDLADMPDDLGHIQKRSGQTPLLWAASNGHHAIVKRLLADGCIDLEQRDEQGRTPLW
LAAERGDVTIVKTLLDLGADCNVEASDGSHTEPGAKANPPLSRDAVETTETKPRAGDTISADWPLAILPFPTTEI
SPVPMPENSSTLGVTGFTSQLSTDDQSLETKSVEAMASDAALHAVADEPKYFQPGELG*
Coding >Hirsu2|955
ATGCGTCTGATAAGCACAGCGACATTCAAGGTGGAGGAGTTTCTCAACGATGAACTCCCACCATACGCCATATTA
TCGCATACATGGGGGGAAGACGAAGAGGAGGTGACTCTCCGCGACATCCAGAATGGAGCTTTCAACAAACTAGGG
AATGGATATATCAAGTTACAAGGTTGCTGTGAGCAAGCTAAGAAGAATGGACTGCGGTACGCCTGGATCGATACC
TGCTGCATCAATAAGGAGAGCTCTAGCGAAATTGAAGAGGCCATCAACTCAATGTTTCAGTGGTATAGCAAGGCT
TCCGTCTGCTACGCCTTTCTCTCGGATGTCTTTCCGGGCGACACCCCCGGGAGCGAGGCGTCCAAATTTTCCTCG
AGCCGCTGGTTCGGACGAGGGTGGACCCTTCAGGAGCTTCTGGCTCCGACGAAGCTGTGTTTCTACGACCAAAAT
TGGACTCTCCTGGGGACTAAAACGTCCCTGTCAGCCGTCGTCGAGGATATCACCGGCATACCTCGTCCGTTCTTG
CTAGGTTCAGTGCCGTTGTCTGAGGCGAGCGTGGCGCAGCGCATGTCCTGGGCTGCGAAGAGACGCACGAAGAGA
AGGGAAGATATTGCGTATTGCCTTCTGGGAATCTTCCGGGTGAACATGCCCATGATATATGGCGAAGGTGACGAT
GCTTTCCGTCGACTGCAAGAAGCCATCATGAAGAATACAGGAGACGAGTCTATCCTGGCATGGGGCTTTAGCCCT
CAGAGTTCATTGCCCAGCAGAACAACTAATGTCGTCTCCAGGGGTGTTCTCGCCACTTCCCCGGCCGACTTTGCA
AACTGTCAAACTATTGTCACGAGAGAGTTTGGCAAGTCGCTACTAAATACTTTCGAAATATCCGCCGGCCATCTC
CGGGCGCACCTCTCTCTGCACACCACCTCGGCTGGCGATAGATACGGCCTGCTCAACTGCGGCCATAGGGACCAA
CCAGAACATATTGTGGGCGTTCCCCTCGCCAGCGCCGAACACAGAGAGCCATCCAACAGTTCATGTTTAATCAGA
CCTCAAGGATGCCCCTCGATTTTATTTTCAAGGACTGCTTCGCGTACGCCTCCCACGGCCGTCTACGTCCGGACC
GAGCGGCCGGACACAGCCACGGATCGACGCTACTGGTTCTATATCGATGACTCCAAAACTGACCTGAAGCTCATC
GATGTCTATCCCCGCTTCCGCTGGAAAGAAGAATGGGCCATGATTGCGACGACCTATTCTCCAGACAGCAGTACA
TGTGTCTTACAACGATCCTTGGCTCGATTCCGGACCCGCGATCGAGAATGTCGAGACGTCATAGTCGTACTTGAG
TTCCAGGCACAGCAGTTGCAACGATCCGCACGATACCACGTCATGACGTGCTCCGGAAATCTCAATCTGGCGGAT
TTATCGAAGAGATTCGTTTTCATGGACAACAAGATGTTTGGAAAGCAGGGCGCGAGCTACGGCCGACGCAATTTG
TCCGTTACTGTCAAGGAGGAATTGATAGGGAAGCACCCGAGGTTTGTTGTCCGACTGGCCACCGTGTCTACCGTA
CCGGAGATAACTGTGGATGCGACCCGGGAGCTGCGGCTTCTGGGATTGAGGCAAGATTTGGTGAGAGTCTGGCAT
CAAGAAGAGAGAATGCGCCCCGAGGTCGAAAGAGTGTGCCAGGACAAGATGGAAACAATGGCTGCTATGGCGTCG
TGGAGGAAACGTCTGGGGTTAATAGAGGAAGAGTTGAAAGGGCTCATCAAGGAAAGGATATTCCTGAGCGGAGCA
GCAGCAAGGTCTGGGGAGATGCTACAGACAATGCTCGATACAGACACGATCGACGTCGACTTGGCGGATATGCCA
GATGATCTTGGACATATTCAGAAGAGGAGCGGCCAGACACCATTACTGTGGGCGGCCTCAAATGGGCACCATGCG
ATCGTCAAAAGGCTTCTTGCGGACGGTTGCATTGATCTGGAGCAAAGAGACGAGCAGGGCCGAACGCCGCTGTGG
TTAGCCGCGGAGAGGGGAGACGTGACGATTGTCAAGACGCTTCTCGACTTGGGCGCTGATTGCAACGTAGAGGCC
AGCGACGGCAGCCACACGGAACCGGGAGCGAAAGCCAACCCACCGCTATCAAGAGACGCAGTCGAGACGACCGAG
ACGAAGCCCCGAGCCGGGGACACCATTTCAGCCGACTGGCCTCTGGCGATTCTTCCTTTTCCAACGACAGAGATC
TCGCCTGTCCCCATGCCGGAAAACTCCTCGACGCTCGGGGTTACCGGCTTCACCTCACAGCTATCAACGGACGAC
CAGTCCCTCGAAACAAAGTCTGTCGAAGCCATGGCGAGCGATGCAGCGTTGCATGCCGTAGCTGACGAGCCCAAG
TACTTCCAGCCAGGAGAGCTCGGCTGA
Transcript >Hirsu2|955
ATGCGTCTGATAAGCACAGCGACATTCAAGGTGGAGGAGTTTCTCAACGATGAACTCCCACCATACGCCATATTA
TCGCATACATGGGGGGAAGACGAAGAGGAGGTGACTCTCCGCGACATCCAGAATGGAGCTTTCAACAAACTAGGG
AATGGATATATCAAGTTACAAGGTTGCTGTGAGCAAGCTAAGAAGAATGGACTGCGGTACGCCTGGATCGATACC
TGCTGCATCAATAAGGAGAGCTCTAGCGAAATTGAAGAGGCCATCAACTCAATGTTTCAGTGGTATAGCAAGGCT
TCCGTCTGCTACGCCTTTCTCTCGGATGTCTTTCCGGGCGACACCCCCGGGAGCGAGGCGTCCAAATTTTCCTCG
AGCCGCTGGTTCGGACGAGGGTGGACCCTTCAGGAGCTTCTGGCTCCGACGAAGCTGTGTTTCTACGACCAAAAT
TGGACTCTCCTGGGGACTAAAACGTCCCTGTCAGCCGTCGTCGAGGATATCACCGGCATACCTCGTCCGTTCTTG
CTAGGTTCAGTGCCGTTGTCTGAGGCGAGCGTGGCGCAGCGCATGTCCTGGGCTGCGAAGAGACGCACGAAGAGA
AGGGAAGATATTGCGTATTGCCTTCTGGGAATCTTCCGGGTGAACATGCCCATGATATATGGCGAAGGTGACGAT
GCTTTCCGTCGACTGCAAGAAGCCATCATGAAGAATACAGGAGACGAGTCTATCCTGGCATGGGGCTTTAGCCCT
CAGAGTTCATTGCCCAGCAGAACAACTAATGTCGTCTCCAGGGGTGTTCTCGCCACTTCCCCGGCCGACTTTGCA
AACTGTCAAACTATTGTCACGAGAGAGTTTGGCAAGTCGCTACTAAATACTTTCGAAATATCCGCCGGCCATCTC
CGGGCGCACCTCTCTCTGCACACCACCTCGGCTGGCGATAGATACGGCCTGCTCAACTGCGGCCATAGGGACCAA
CCAGAACATATTGTGGGCGTTCCCCTCGCCAGCGCCGAACACAGAGAGCCATCCAACAGTTCATGTTTAATCAGA
CCTCAAGGATGCCCCTCGATTTTATTTTCAAGGACTGCTTCGCGTACGCCTCCCACGGCCGTCTACGTCCGGACC
GAGCGGCCGGACACAGCCACGGATCGACGCTACTGGTTCTATATCGATGACTCCAAAACTGACCTGAAGCTCATC
GATGTCTATCCCCGCTTCCGCTGGAAAGAAGAATGGGCCATGATTGCGACGACCTATTCTCCAGACAGCAGTACA
TGTGTCTTACAACGATCCTTGGCTCGATTCCGGACCCGCGATCGAGAATGTCGAGACGTCATAGTCGTACTTGAG
TTCCAGGCACAGCAGTTGCAACGATCCGCACGATACCACGTCATGACGTGCTCCGGAAATCTCAATCTGGCGGAT
TTATCGAAGAGATTCGTTTTCATGGACAACAAGATGTTTGGAAAGCAGGGCGCGAGCTACGGCCGACGCAATTTG
TCCGTTACTGTCAAGGAGGAATTGATAGGGAAGCACCCGAGGTTTGTTGTCCGACTGGCCACCGTGTCTACCGTA
CCGGAGATAACTGTGGATGCGACCCGGGAGCTGCGGCTTCTGGGATTGAGGCAAGATTTGGTGAGAGTCTGGCAT
CAAGAAGAGAGAATGCGCCCCGAGGTCGAAAGAGTGTGCCAGGACAAGATGGAAACAATGGCTGCTATGGCGTCG
TGGAGGAAACGTCTGGGGTTAATAGAGGAAGAGTTGAAAGGGCTCATCAAGGAAAGGATATTCCTGAGCGGAGCA
GCAGCAAGGTCTGGGGAGATGCTACAGACAATGCTCGATACAGACACGATCGACGTCGACTTGGCGGATATGCCA
GATGATCTTGGACATATTCAGAAGAGGAGCGGCCAGACACCATTACTGTGGGCGGCCTCAAATGGGCACCATGCG
ATCGTCAAAAGGCTTCTTGCGGACGGTTGCATTGATCTGGAGCAAAGAGACGAGCAGGGCCGAACGCCGCTGTGG
TTAGCCGCGGAGAGGGGAGACGTGACGATTGTCAAGACGCTTCTCGACTTGGGCGCTGATTGCAACGTAGAGGCC
AGCGACGGCAGCCACACGGAACCGGGAGCGAAAGCCAACCCACCGCTATCAAGAGACGCAGTCGAGACGACCGAG
ACGAAGCCCCGAGCCGGGGACACCATTTCAGCCGACTGGCCTCTGGCGATTCTTCCTTTTCCAACGACAGAGATC
TCGCCTGTCCCCATGCCGGAAAACTCCTCGACGCTCGGGGTTACCGGCTTCACCTCACAGCTATCAACGGACGAC
CAGTCCCTCGAAACAAAGTCTGTCGAAGCCATGGCGAGCGATGCAGCGTTGCATGCCGTAGCTGACGAGCCCAAG
TACTTCCAGCCAGGAGAGCTCGGCTGA
Gene >Hirsu2|955
ATGCGTCTGATAAGCACAGCGACATTCAAGGTGGAGGAGTTTCTCAACGATGAACTCCCACCATACGCCATATTA
TCGCATACATGGGGGGAAGACGAAGAGGAGGTGACTCTCCGCGACATCCAGAATGGAGCTTTCAACAAACTAGGG
AATGGATATATCAAGTTACAAGGTTGCTGTGAGCAAGCTAAGAAGAATGGACTGCGGTACGCCTGGATCGATACC
TGCTGCATCAATAAGGAGAGCTCTAGCGAAATTGAAGAGGCCATCAACTCAATGTTTCAGTGGTATAGCAAGGCT
TCCGTCTGCTACGCCTTTCTCTCGGATGTCTTTCCGGGCGACACCCCCGGGAGCGAGGCGTCCAAATTTTCCTCG
AGCCGCTGGTTCGGACGAGGGTGGACCCTTCAGGAGCTTCTGGCTCCGACGAAGCTGTGTTTCTACGACCAAAAT
TGGACTCTCCTGGGGACTAAAACGTCCCTGTCAGCCGTCGTCGAGGATATCACCGGCATACCTCGTCCGTTCTTG
CTAGGTTCAGTGCCGTTGTCTGAGGCGAGCGTGGCGCAGCGCATGTCCTGGGCTGCGAAGAGACGCACGAAGAGA
AGGGAAGATATTGCGTATTGCCTTCTGGGAATCTTCCGGGTGAACATGCCCATGATATATGGCGAAGGTGACGAT
GCTTTCCGTCGACTGCAAGAAGCCATCATGAAGAATACAGGAGACGAGTCTATCCTGGCATGGGGCTTTAGCCCT
CAGAGTTCATTGCCCAGCAGAACAACTAATGTCGTCTCCAGGGGTGTTCTCGCCACTTCCCCGGCCGACTTTGCA
AACTGTCAAACTATTGTCACGAGAGAGTTTGGCAAGTCGCTACTAAATACTTTCGAAATATCCGCCGGCCATCTC
CGGGCGCACCTCTCTCTGCACACCACCTCGGCTGGCGATAGATACGGCCTGCTCAACTGCGGCCATAGGGACCAA
CCAGAACATATTGTGGGCGTTCCCCTCGCCAGCGCCGAACACAGAGAGCCATCCAACAGTTCATGTTTAATCAGA
CCTCAAGGATGCCCCTCGATTTTATTTTCAAGGACTGCTTCGCGTACGCCTCCCACGGCCGTCTACGTCCGGACC
GAGCGGCCGGACACAGCCACGGATCGACGCTACTGGTTCTATATCGATGACTCCAAAACTGACCTGAAGCTCATC
GATGTCTATCCCCGCTTCCGCTGGAAAGAAGAATGGGCCATGATTGCGACGACCTATTCTCCAGACAGCAGTACA
TGTGTCTTACAACGATCCTTGGCTCGATTCCGGACCCGCGATCGAGAATGTCGAGACGTCATAGTCGTACTTGAG
TTCCAGGCACAGCAGTTGCAACGATCCGCACGATACCACGTCATGACGTGCTCCGGAAATCTCAATCTGGCGGAT
TTATCGAAGAGATTCGTTTTCATGGACAACAAGATGTTTGGAAAGCAGGGCGCGAGCTACGGCCGACGCAATTTG
TCCGTTACTGTCAAGGAGGAATTGATAGGGAAGCACCCGAGGTTTGTTGTCCGACTGGCCACCGTGTCTACCGTA
CCGGAGATAACTGTGGATGCGACCCGGGAGCTGCGGCTTCTGGGATTGAGGCAAGATTTGGTGAGAGTCTGGCAT
CAAGAAGAGAGAATGCGCCCCGAGGTCGAAAGAGTGTGCCAGGACAAGATGGAAACAATGGCTGCTATGGCGTCG
TGGAGGAAACGTCTGGGGTTAATAGAGGAAGAGTTGAAAGGGCTCATCAAGGAAAGGATATTCCTGAGTAGGAAA
GATCAGAGGGGGGCTAAGAAAGTGGAACAACTGATGATAAGACAAGATCAAATCAGGCAGGAACAAGACGGGCTC
TCGATGAGGGAATCATCAATACTTGGAAAACTCGCGGACGACTCCGAAAGGCGGAGCAGCAGCAAGGTCTGGGGA
GATGCTACAGACAATGCTCGATACAGACACGATCGACGTCGACTTGGCGGATATGCCAGATGATCTTGGACATAT
TCAGAAGAGGAGCGGCCAGACACCATTACTGTGGGCGGCCTCAAATGGGCACCATGCGATCGTCAAAAGGCTTCT
TGCGGACGGTTGCATTGATCTGGAGCAAAGAGACGAGCAGGGCCGAACGCCGCTGTGGTTAGCCGCGGAGAGGGG
AGACGTGACGATTGTCAAGACGCTTCTCGACTTGGGCGCTGATTGCAACGTAGAGGCCAGCGACGGCAGCCACAC
GGAACCGGGAGCGAAAGCCAACCCACCGCTATCAAGAGACGCAGTCGAGACGACCGAGACGAAGCCCCGAGCCGG
GGACACCATTTCAGCCGACTGGCCTCTGGCGATTCTTCCTTTTCCAACGACAGAGATCTCGCCTGTCCCCATGCC
GGAAAACTCCTCGACGCTCGGGGTTACCGGCTTCACCTCACAGCTATCAACGGACGACCAGTCCCTCGAAACAAA
GTCTGTCGAAGCCATGGCGAGCGATGCAGCGTTGCATGCCGTAGCTGACGAGCCCAAGTACTTCCAGCCAGGAGA
GCTCGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail