Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9545
Gene name
LocationContig_7:75968..79313
Strand+
Gene length (bp)3345
Transcript length (bp)3207
Coding sequence length (bp)3207
Protein length (aa) 1069

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03439 Spt5-NGN Early transcription elongation factor of RNA pol II, NGN section 1.1E-22 223 312
PF11942 Spt5_N Spt5 transcription elongation factor, acidic N-terminal 8.5E-22 122 217
PF12815 CTD Spt5 C-terminal nonapeptide repeat binding Spt4 3.4E-06 827 869
PF12815 CTD Spt5 C-terminal nonapeptide repeat binding Spt4 8.9E-18 861 945

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S3C4|SPT5_NEUCR Transcription elongation factor spt5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=trf-3 PE=3 SV=3 121 1036 0.0E+00
sp|Q2UGU3|SPT5_ASPOR Transcription elongation factor spt5 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=spt5 PE=3 SV=1 153 1066 0.0E+00
sp|Q4WP96|SPT5_ASPFU Transcription elongation factor spt5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=spt5 PE=3 SV=1 104 1047 0.0E+00
sp|Q5BCN2|SPT5_EMENI Transcription elongation factor spt5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=spt5 PE=3 SV=1 9 1047 0.0E+00
sp|O13936|SPT5_SCHPO Transcription elongation factor spt5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spt5 PE=1 SV=1 165 995 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S3C4|SPT5_NEUCR Transcription elongation factor spt5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=trf-3 PE=3 SV=3 121 1036 0.0E+00
sp|Q2UGU3|SPT5_ASPOR Transcription elongation factor spt5 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=spt5 PE=3 SV=1 153 1066 0.0E+00
sp|Q4WP96|SPT5_ASPFU Transcription elongation factor spt5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=spt5 PE=3 SV=1 104 1047 0.0E+00
sp|Q5BCN2|SPT5_EMENI Transcription elongation factor spt5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=spt5 PE=3 SV=1 9 1047 0.0E+00
sp|O13936|SPT5_SCHPO Transcription elongation factor spt5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spt5 PE=1 SV=1 165 995 0.0E+00
sp|Q6CC84|SPT5_YARLI Transcription elongation factor SPT5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SPT5 PE=3 SV=1 110 1025 0.0E+00
sp|Q4I5I4|SPT5_GIBZE Transcription elongation factor SPT5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SPT5 PE=3 SV=1 1 1068 0.0E+00
sp|P0CR70|SPT5_CRYNJ Transcription elongation factor SPT5 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SPT5 PE=3 SV=1 144 1047 6.0E-154
sp|P0CR71|SPT5_CRYNB Transcription elongation factor SPT5 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SPT5 PE=3 SV=1 144 1047 7.0E-154
sp|Q4PIC4|SPT5_USTMA Transcription elongation factor SPT5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SPT5 PE=3 SV=2 148 935 9.0E-142
sp|Q6BZG0|SPT5_DEBHA Transcription elongation factor SPT5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SPT5 PE=3 SV=2 110 960 4.0E-138
sp|Q5ALX3|SPT5_CANAL Transcription elongation factor SPT5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SPT5 PE=3 SV=1 10 869 1.0E-115
sp|Q6FRZ5|SPT5_CANGA Transcription elongation factor SPT5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SPT5 PE=3 SV=1 113 960 4.0E-111
sp|Q6CWW9|SPT5_KLULA Transcription elongation factor SPT5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SPT5 PE=3 SV=1 108 960 8.0E-110
sp|P27692|SPT5_YEAST Transcription elongation factor SPT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPT5 PE=1 SV=1 80 879 8.0E-110
sp|Q759T6|SPT5_ASHGO Transcription elongation factor SPT5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SPT5 PE=3 SV=2 110 986 4.0E-101
sp|O55201|SPT5H_MOUSE Transcription elongation factor SPT5 OS=Mus musculus GN=Supt5h PE=1 SV=1 135 1059 2.0E-95
sp|O00267|SPT5H_HUMAN Transcription elongation factor SPT5 OS=Homo sapiens GN=SUPT5H PE=1 SV=1 135 1059 3.0E-91
sp|Q5R405|SPT5H_PONAB Transcription elongation factor SPT5 OS=Pongo abelii GN=SUPT5H PE=2 SV=1 210 1059 9.0E-91
sp|Q5ZI08|SPT5H_CHICK Transcription elongation factor SPT5 OS=Gallus gallus GN=SUPT5H PE=2 SV=1 135 1059 2.0E-90
sp|Q9V460|SPT5H_DROME Transcription elongation factor SPT5 OS=Drosophila melanogaster GN=Spt5 PE=1 SV=1 170 1011 3.0E-89
sp|Q21338|SPT5H_CAEEL Transcription elongation factor SPT5 OS=Caenorhabditis elegans GN=spt-5 PE=3 SV=3 206 1061 1.0E-87
sp|Q9DDT5|SPT5H_DANRE Transcription elongation factor SPT5 OS=Danio rerio GN=supt5h PE=1 SV=1 210 1062 8.0E-86
sp|O80770|SPT52_ARATH Putative transcription elongation factor SPT5 homolog 2 OS=Arabidopsis thaliana GN=At2g34210 PE=3 SV=2 210 1008 8.0E-58
sp|F4JW79|RDM3_ARATH Protein RNA-directed DNA methylation 3 OS=Arabidopsis thaliana GN=RDM3 PE=1 SV=1 108 451 1.0E-23
sp|F4JW79|RDM3_ARATH Protein RNA-directed DNA methylation 3 OS=Arabidopsis thaliana GN=RDM3 PE=1 SV=1 595 805 1.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9545
MAPDEPPRFDDSEDEEDFNPAPADMSDEEAAEEDGRRAKKAARHDSPGDRDAAAEDFESSPPRPRAGGDADESAR
RHGADDDDDDRDEEEEEEEEDEDDDDEDEDVQQGHRRKRRRDRRNAFFDIEAEVDDEDEGEDEEKDGEEIEDFID
NAHPDDVAESARLDDDRRHRELDRRREMEASMDAEKQAEILRQRYGNRRPAKGFGDSAVVPKRLLLPSVDDPSIW
AVRCKEGKEREVVLSITKRIEERLGTKDELAITAAFERGGAQSVMKGFIYVEAQRQTDILVALDGMLNVYPRSKM
TLVDIKDMPELLRVTKTPILEPGAWVRLRRPAKHSGDLAQVLDVTENGLEAKVRFIPRLDYGMRDDALAAVTPDG
KRKRPGGIAGPKPPQRLFSEVEARKRHPRHIQGNPSTNTWSYMGDEFENGFQVKDVKIQQLVVTDVNPSLEEVTR
FASGAEDGTENLDLKALAASLKDSNTLVTYLPGDIIEVYSGEQKGVVGKATNVQGDIVTMAVTEGDLEGQTIEVP
IKGLRKRFKIGDHVKVIGGSKFRDEVGTVVKISEDRVTLLTDQTNTEVTVFSKDLREASDIGGQGSLGQFSLHDL
VQLDPTTVGCIVKVDRESLVVLDQNGDTRQVMPTQIANKLPKRKQAVAADRDGSEIRLDDKVKEFTGQQRQGKII
HIHRSYIFLHTNDSTENAGVFVTKASMVNTIAAKGGRVNAATSGPDLNAMNPALKIHKNGAENKAMQPPVKTFGR
DRAINQTAIIRKGPYKGLLGIVKDTTDTHARVELHTKGKTITVPRESLSFRDKTTGATIDINGRGRAPPGGPNRG
PSDRVPGWQGGSRTPVGAGSSDRVPAWGSRTPSAAGGRTPAWKAQDYSGSRTPAWADGSRTVNPYDGNRTAYGSG
SRTPAWQSGARTPAVGDAFGAGSRTPAYGGGTDGWTSGSKTPAWGSSAPTPGASGNDSWGYTPGATSAAYDAPTP
GAGMGAPTPGALNAPTPGAYSAPTPAVSAPTPGGGWQGGWGPETAPTPGAGAPTPGATGFASSSGYYGAPTPAAY
GGAPETPAASGPRYTDDD*
Coding >Hirsu2|9545
ATGGCTCCGGACGAGCCGCCTCGGTTTGACGACTCGGAAGACGAGGAGGACTTTAACCCCGCGCCCGCCGACATG
TCTGACGAGGAAGCTGCCGAAGAGGACGGCAGGCGGGCAAAGAAAGCAGCCCGCCACGATAGCCCAGGCGACCGG
GACGCCGCTGCGGAAGACTTTGAATCATCGCCCCCGAGACCGCGGGCTGGCGGCGACGCCGATGAGTCCGCGCGG
CGTCATGGCGCCGACGACGACGACGACGACCGGGACGAAGAGGAAGAAGAAGAGGAAGAGGACGAAGATGATGAT
GACGAGGATGAAGACGTTCAGCAGGGTCATCGCCGCAAACGACGCCGAGACCGTCGCAATGCTTTTTTCGATATC
GAGGCCGAGGTGGATGACGAGGATGAGGGAGAGGACGAGGAGAAGGACGGCGAGGAGATTGAAGACTTCATCGAC
AACGCCCACCCCGATGACGTGGCCGAAAGTGCCCGACTAGACGACGATCGAAGGCATCGTGAACTCGATCGTCGC
CGGGAGATGGAGGCAAGCATGGACGCGGAGAAACAGGCCGAGATCCTTCGCCAGCGATACGGCAACCGTCGGCCT
GCCAAAGGATTCGGCGACTCGGCCGTCGTACCAAAGCGTCTTCTGCTACCGAGTGTCGACGACCCCAGTATATGG
GCCGTCAGGTGTAAAGAAGGGAAAGAGCGCGAGGTCGTCCTCTCCATCACCAAGAGGATCGAAGAGCGTCTGGGG
ACCAAGGACGAGCTCGCCATCACGGCTGCCTTTGAGCGCGGCGGCGCTCAGTCGGTCATGAAGGGATTCATCTAC
GTCGAGGCCCAGCGGCAGACGGACATTCTCGTCGCACTGGACGGCATGCTCAACGTCTATCCCCGCTCCAAGATG
ACGCTGGTGGACATCAAGGACATGCCTGAGCTCCTTCGAGTCACCAAGACCCCGATCCTCGAGCCTGGAGCCTGG
GTCCGTCTCCGAAGGCCCGCCAAGCACAGCGGAGACCTGGCCCAAGTCCTGGACGTGACGGAAAACGGCCTGGAG
GCAAAGGTTCGGTTCATCCCGAGGCTGGACTATGGCATGCGGGACGACGCTCTGGCAGCTGTGACGCCCGACGGC
AAGAGGAAACGCCCTGGCGGAATTGCCGGACCAAAGCCGCCGCAGAGGCTCTTTAGCGAAGTCGAGGCCCGGAAG
CGCCATCCCCGCCACATCCAAGGGAACCCATCGACCAACACCTGGTCCTACATGGGGGATGAGTTTGAGAACGGT
TTCCAGGTCAAAGACGTCAAGATACAGCAGCTGGTAGTGACCGACGTCAACCCGTCGCTGGAGGAGGTGACCCGC
TTTGCCTCCGGCGCCGAGGACGGCACCGAGAACCTCGATCTCAAGGCTCTCGCGGCCAGTTTGAAGGATAGCAAC
ACACTCGTCACCTACCTTCCGGGAGACATTATCGAGGTCTATTCGGGAGAGCAGAAAGGTGTTGTGGGCAAGGCA
ACCAACGTCCAGGGCGACATCGTCACCATGGCTGTCACGGAGGGGGATCTGGAGGGCCAGACGATTGAGGTGCCC
ATCAAGGGACTGCGGAAGCGCTTCAAGATTGGCGACCACGTCAAGGTGATCGGAGGAAGCAAGTTCCGAGATGAG
GTCGGAACCGTCGTCAAGATCTCCGAGGACCGCGTCACGCTCCTGACGGACCAGACAAACACCGAGGTAACGGTG
TTCAGCAAAGACCTGCGCGAGGCCAGCGACATTGGCGGGCAAGGGTCTCTCGGGCAGTTCTCGCTCCACGATCTG
GTCCAGCTCGACCCCACCACCGTGGGCTGCATCGTCAAGGTCGATCGAGAGTCGCTCGTGGTCCTCGATCAGAAC
GGTGACACGCGGCAGGTCATGCCAACGCAGATCGCCAATAAGCTGCCCAAGCGGAAGCAGGCAGTTGCGGCCGAC
CGCGACGGCTCCGAAATCAGGCTCGACGACAAAGTGAAGGAGTTCACCGGCCAGCAGCGGCAGGGCAAGATCATT
CACATACACCGATCCTACATCTTCCTGCATACCAACGACAGCACCGAGAACGCAGGAGTCTTCGTCACCAAGGCC
AGCATGGTAAACACGATTGCGGCCAAGGGCGGCCGGGTGAATGCCGCCACGTCGGGCCCCGACCTGAACGCCATG
AACCCGGCCTTGAAGATCCACAAGAACGGCGCCGAGAACAAGGCGATGCAGCCGCCAGTCAAGACGTTCGGCCGT
GACCGGGCCATAAACCAGACGGCCATCATCAGGAAGGGCCCGTACAAGGGTTTGCTGGGCATCGTAAAAGACACG
ACAGACACACATGCCCGCGTCGAACTGCACACCAAGGGCAAGACCATCACGGTGCCCCGGGAGTCACTGAGCTTC
AGGGACAAGACAACAGGCGCCACCATTGACATCAACGGCAGAGGCCGGGCTCCACCAGGCGGGCCAAACCGGGGG
CCGAGCGACAGGGTCCCAGGTTGGCAAGGAGGCTCCCGCACGCCGGTCGGCGCCGGAAGCTCTGACCGAGTCCCT
GCTTGGGGTTCACGCACCCCCTCGGCAGCTGGCGGGCGAACGCCGGCCTGGAAAGCGCAAGATTACTCGGGCTCA
CGGACTCCAGCCTGGGCGGATGGCTCGAGGACCGTCAATCCCTACGACGGAAACCGAACCGCATATGGCTCGGGT
TCGCGGACGCCAGCCTGGCAGTCGGGAGCCCGGACACCAGCGGTGGGTGACGCCTTCGGAGCCGGATCCCGAACC
CCGGCCTACGGGGGTGGTACGGATGGCTGGACATCGGGGTCCAAGACGCCGGCATGGGGGTCGTCTGCGCCGACG
CCGGGGGCCAGTGGCAACGACTCGTGGGGGTACACTCCGGGGGCCACGTCGGCCGCCTACGACGCGCCGACCCCA
GGGGCGGGCATGGGCGCTCCCACACCAGGCGCGCTGAACGCGCCGACCCCCGGGGCCTATTCGGCGCCAACGCCT
GCTGTCAGCGCTCCGACCCCCGGCGGGGGCTGGCAAGGAGGGTGGGGGCCGGAGACGGCGCCGACGCCGGGAGCC
GGAGCTCCGACCCCCGGGGCCACTGGGTTCGCCAGCTCATCCGGCTACTATGGAGCGCCAACTCCGGCAGCGTAC
GGCGGAGCGCCGGAGACGCCAGCCGCCAGTGGACCGAGGTACACAGACGACGACTAG
Transcript >Hirsu2|9545
ATGGCTCCGGACGAGCCGCCTCGGTTTGACGACTCGGAAGACGAGGAGGACTTTAACCCCGCGCCCGCCGACATG
TCTGACGAGGAAGCTGCCGAAGAGGACGGCAGGCGGGCAAAGAAAGCAGCCCGCCACGATAGCCCAGGCGACCGG
GACGCCGCTGCGGAAGACTTTGAATCATCGCCCCCGAGACCGCGGGCTGGCGGCGACGCCGATGAGTCCGCGCGG
CGTCATGGCGCCGACGACGACGACGACGACCGGGACGAAGAGGAAGAAGAAGAGGAAGAGGACGAAGATGATGAT
GACGAGGATGAAGACGTTCAGCAGGGTCATCGCCGCAAACGACGCCGAGACCGTCGCAATGCTTTTTTCGATATC
GAGGCCGAGGTGGATGACGAGGATGAGGGAGAGGACGAGGAGAAGGACGGCGAGGAGATTGAAGACTTCATCGAC
AACGCCCACCCCGATGACGTGGCCGAAAGTGCCCGACTAGACGACGATCGAAGGCATCGTGAACTCGATCGTCGC
CGGGAGATGGAGGCAAGCATGGACGCGGAGAAACAGGCCGAGATCCTTCGCCAGCGATACGGCAACCGTCGGCCT
GCCAAAGGATTCGGCGACTCGGCCGTCGTACCAAAGCGTCTTCTGCTACCGAGTGTCGACGACCCCAGTATATGG
GCCGTCAGGTGTAAAGAAGGGAAAGAGCGCGAGGTCGTCCTCTCCATCACCAAGAGGATCGAAGAGCGTCTGGGG
ACCAAGGACGAGCTCGCCATCACGGCTGCCTTTGAGCGCGGCGGCGCTCAGTCGGTCATGAAGGGATTCATCTAC
GTCGAGGCCCAGCGGCAGACGGACATTCTCGTCGCACTGGACGGCATGCTCAACGTCTATCCCCGCTCCAAGATG
ACGCTGGTGGACATCAAGGACATGCCTGAGCTCCTTCGAGTCACCAAGACCCCGATCCTCGAGCCTGGAGCCTGG
GTCCGTCTCCGAAGGCCCGCCAAGCACAGCGGAGACCTGGCCCAAGTCCTGGACGTGACGGAAAACGGCCTGGAG
GCAAAGGTTCGGTTCATCCCGAGGCTGGACTATGGCATGCGGGACGACGCTCTGGCAGCTGTGACGCCCGACGGC
AAGAGGAAACGCCCTGGCGGAATTGCCGGACCAAAGCCGCCGCAGAGGCTCTTTAGCGAAGTCGAGGCCCGGAAG
CGCCATCCCCGCCACATCCAAGGGAACCCATCGACCAACACCTGGTCCTACATGGGGGATGAGTTTGAGAACGGT
TTCCAGGTCAAAGACGTCAAGATACAGCAGCTGGTAGTGACCGACGTCAACCCGTCGCTGGAGGAGGTGACCCGC
TTTGCCTCCGGCGCCGAGGACGGCACCGAGAACCTCGATCTCAAGGCTCTCGCGGCCAGTTTGAAGGATAGCAAC
ACACTCGTCACCTACCTTCCGGGAGACATTATCGAGGTCTATTCGGGAGAGCAGAAAGGTGTTGTGGGCAAGGCA
ACCAACGTCCAGGGCGACATCGTCACCATGGCTGTCACGGAGGGGGATCTGGAGGGCCAGACGATTGAGGTGCCC
ATCAAGGGACTGCGGAAGCGCTTCAAGATTGGCGACCACGTCAAGGTGATCGGAGGAAGCAAGTTCCGAGATGAG
GTCGGAACCGTCGTCAAGATCTCCGAGGACCGCGTCACGCTCCTGACGGACCAGACAAACACCGAGGTAACGGTG
TTCAGCAAAGACCTGCGCGAGGCCAGCGACATTGGCGGGCAAGGGTCTCTCGGGCAGTTCTCGCTCCACGATCTG
GTCCAGCTCGACCCCACCACCGTGGGCTGCATCGTCAAGGTCGATCGAGAGTCGCTCGTGGTCCTCGATCAGAAC
GGTGACACGCGGCAGGTCATGCCAACGCAGATCGCCAATAAGCTGCCCAAGCGGAAGCAGGCAGTTGCGGCCGAC
CGCGACGGCTCCGAAATCAGGCTCGACGACAAAGTGAAGGAGTTCACCGGCCAGCAGCGGCAGGGCAAGATCATT
CACATACACCGATCCTACATCTTCCTGCATACCAACGACAGCACCGAGAACGCAGGAGTCTTCGTCACCAAGGCC
AGCATGGTAAACACGATTGCGGCCAAGGGCGGCCGGGTGAATGCCGCCACGTCGGGCCCCGACCTGAACGCCATG
AACCCGGCCTTGAAGATCCACAAGAACGGCGCCGAGAACAAGGCGATGCAGCCGCCAGTCAAGACGTTCGGCCGT
GACCGGGCCATAAACCAGACGGCCATCATCAGGAAGGGCCCGTACAAGGGTTTGCTGGGCATCGTAAAAGACACG
ACAGACACACATGCCCGCGTCGAACTGCACACCAAGGGCAAGACCATCACGGTGCCCCGGGAGTCACTGAGCTTC
AGGGACAAGACAACAGGCGCCACCATTGACATCAACGGCAGAGGCCGGGCTCCACCAGGCGGGCCAAACCGGGGG
CCGAGCGACAGGGTCCCAGGTTGGCAAGGAGGCTCCCGCACGCCGGTCGGCGCCGGAAGCTCTGACCGAGTCCCT
GCTTGGGGTTCACGCACCCCCTCGGCAGCTGGCGGGCGAACGCCGGCCTGGAAAGCGCAAGATTACTCGGGCTCA
CGGACTCCAGCCTGGGCGGATGGCTCGAGGACCGTCAATCCCTACGACGGAAACCGAACCGCATATGGCTCGGGT
TCGCGGACGCCAGCCTGGCAGTCGGGAGCCCGGACACCAGCGGTGGGTGACGCCTTCGGAGCCGGATCCCGAACC
CCGGCCTACGGGGGTGGTACGGATGGCTGGACATCGGGGTCCAAGACGCCGGCATGGGGGTCGTCTGCGCCGACG
CCGGGGGCCAGTGGCAACGACTCGTGGGGGTACACTCCGGGGGCCACGTCGGCCGCCTACGACGCGCCGACCCCA
GGGGCGGGCATGGGCGCTCCCACACCAGGCGCGCTGAACGCGCCGACCCCCGGGGCCTATTCGGCGCCAACGCCT
GCTGTCAGCGCTCCGACCCCCGGCGGGGGCTGGCAAGGAGGGTGGGGGCCGGAGACGGCGCCGACGCCGGGAGCC
GGAGCTCCGACCCCCGGGGCCACTGGGTTCGCCAGCTCATCCGGCTACTATGGAGCGCCAACTCCGGCAGCGTAC
GGCGGAGCGCCGGAGACGCCAGCCGCCAGTGGACCGAGGTACACAGACGACGACTAG
Gene >Hirsu2|9545
ATGGCTCCGGACGAGCCGCCTCGGTTTGACGACTCGGAAGACGAGGAGGACTTTAACCCCGCGCCCGCCGACATG
TCTGACGAGGAAGCTGCCGAAGAGGACGGCAGGCGGGCAAAGAAAGCAGCCCGCCACGATAGCCCAGGCGACCGG
GACGCCGCTGCGGAAGACTTTGAATCATCGCCCCCGAGACCGCGGGCTGGCGGCGACGCCGATGAGTCCGCGCGG
CGTCATGGCGCCGACGACGACGACGACGACCGGGACGAAGAGGAAGAAGAAGAGGAAGAGGACGAAGATGATGAT
GACGAGGATGAAGACGTTCAGCAGGTTCGCTTCCACCTGTCGCTTCCCCGTCCTCATCGTGGCTACTGCTTACGC
ATACGAGTAGGGTCATCGCCGCAAACGACGCCGAGACCGTCGCAATGCTTTTTTCGATATCGAGGCCGAGGTGGA
TGACGAGGATGAGGGAGAGGACGAGGAGAAGGACGGCGAGGAGATTGAAGACTTCATCGACAACGCCCACCCCGA
TGACGTGGCCGAAAGTGCCCGACTAGACGACGATCGAAGGCATCGTGAACTCGATCGTCGCCGGGAGATGGAGGC
AAGCATGGACGCGGAGAAACAGGCCGAGATCCTTCGCCAGCGATACGGCAACCGTCGGCCTGCCAAAGGATTCGG
CGACTCGGCCGTCGTACCAAAGCGTCTTCTGCTACCGAGTGTCGACGACCCCAGTATATGGGCCGTCAGGTGTAA
AGAAGGGAAAGAGCGCGAGGTCGTCCTCTCCATCACCAAGAGGATCGAAGAGCGTCTGGGGACCAAGGACGAGCT
CGCCATCACGGCTGCCTTTGAGCGCGGCGGCGCTCAGTCGGTCATGAAGGGATTCATCTACGTCGAGGCCCAGCG
GCAGACGGACATTCTCGTCGCACTGGACGGCATGCTCAACGTCTATCCCCGCTCCAAGATGACGCTGGTGGACAT
CAAGGACATGCCTGAGCTCCTTCGAGTCACCAAGACCCCGATCCTCGAGCCTGGAGCCTGGGTCCGTCTCCGAAG
GCCCGCCAAGCACAGCGGAGACCTGGCCCAAGTCCTGGACGTGACGGAAAACGGCCTGGAGGCAAAGGTTCGGTT
CATCCCGAGGCTGGACTATGGCATGCGGGACGACGCTCTGGCAGCTGTGACGCCCGACGGCAAGAGGAAACGCCC
TGGCGGAATTGCCGGACCAAAGCCGCCGCAGAGGCTCTTTAGCGAAGTCGAGGCCCGGAAGCGCCATCCCCGCCA
CATCCAAGGGAACCCATCGACCAACACCTGGTCCTACATGGGGGATGAGTTTGAGAACGGTTTCCAGGTCAAAGA
CGTCAAGATACAGCAGCTGGTAGTGACCGACGTCAACCCGTCGCTGGAGGAGGTGACCCGCTTTGCCTCCGGCGC
CGAGGACGGCACCGAGAACCTCGATCTCAAGGCTCTCGCGGCCAGTTTGAAGGATAGCAACACACTCGTCACCTA
CCTTCCGGGAGACATTATCGAGGTCTATTCGGGAGAGCAGAAAGGTGTTGTGGGCAAGGCAACCAACGTCCAGGG
CGACATCGTCACCATGGCTGTCACGGAGGGGGATCTGGAGGGCCAGACGATTGAGGTGCCCATCAAGGGACTGCG
GAAGCGCTTCAAGATTGGCGACCACGTCAAGGTGATCGGAGGAAGCAAGTTCCGAGATGAGGTCGGAACCGTCGT
CAAGATCTCCGAGGACCGCGTCACGCTCCTGACGGACCAGACAAACACCGAGGTAACGGTGTTCAGCAAAGACCT
GCGCGAGGCCAGCGACATTGGCGGGCAAGGGTCTCTCGGGCAGTTCTCGCTCCACGATCTGGTCCAGCTCGACCC
CACCACCGTGGGCTGCATCGTCAAGGTCGATCGAGAGTCGCTCGTGGTCCTCGATCAGAACGGTGACACGCGGCA
GGTCATGCCAACGCAGATCGCCAATAAGCTGCCCAAGCGGAAGCAGGCAGTTGCGGCCGACCGCGACGGCTCCGA
AATCAGGCTCGACGACAAAGTGAAGGAGTTCACCGGCCAGCAGCGGCAGGGCAAGATCATTCACATACACCGATC
CTACATCTTCCTGCATACCAACGACAGCACCGAGAACGCAGGAGTCTTCGTCACCAAGGCCAGCATGGTAAACAC
GATTGCGGCCAAGGGCGGCCGGGTGAATGCCGCCACGTCGGGCCCCGACCTGAACGCCATGAACCCGGCCTTGAA
GATCCACAAGAACGGCGCCGAGAACAAGGCGATGCAGCCGCCAGTCAAGACGTTCGGCCGTGACCGGGCCATAAA
CCAGACGGCCATCATCAGGAAGGGCCCGTACAAGGGTTTGCTGGGCATCGTAAAAGACACGACAGACACACATGC
CCGCGTCGAACTGCACACCAAGGGCAAGACCATCACGGTGCCCCGGGAGTCACTGAGCTTCAGGGACAAGACAAC
AGGCGCCACCATTGACATCAACGGCAGAGGCCGGGCTCCACCAGGCGGGCCAAACCGGGGGCCGAGCGACAGGGT
CCCAGGTTGGCAAGGAGGCTCCCGCACGCCGGTCGGCGCCGGAAGCTCTGACCGAGTCCCTGCTTGGGGTTCACG
CAGTGAGTTTTGGATTCTGGCTTCCCGCCATCTGTGCCCCATTGCCCCATGCCGCCGTGCTGACTGCTTGCTGCG
ACAGCCCCCTCGGCAGCTGGCGGGCGAACGCCGGCCTGGAAAGCGCAAGATTACTCGGGCTCACGGACTCCAGCC
TGGGCGGATGGCTCGAGGACCGTCAATCCCTACGACGGAAACCGAACCGCATATGGCTCGGGTTCGCGGACGCCA
GCCTGGCAGTCGGGAGCCCGGACACCAGCGGTGGGTGACGCCTTCGGAGCCGGATCCCGAACCCCGGCCTACGGG
GGTGGTACGGATGGCTGGACATCGGGGTCCAAGACGCCGGCATGGGGGTCGTCTGCGCCGACGCCGGGGGCCAGT
GGCAACGACTCGTGGGGGTACACTCCGGGGGCCACGTCGGCCGCCTACGACGCGCCGACCCCAGGGGCGGGCATG
GGCGCTCCCACACCAGGCGCGCTGAACGCGCCGACCCCCGGGGCCTATTCGGCGCCAACGCCTGCTGTCAGCGCT
CCGACCCCCGGCGGGGGCTGGCAAGGAGGGTGGGGGCCGGAGACGGCGCCGACGCCGGGAGCCGGAGCTCCGACC
CCCGGGGCCACTGGGTTCGCCAGCTCATCCGGCTACTATGGAGCGCCAACTCCGGCAGCGTACGGCGGAGCGCCG
GAGACGCCAGCCGCCAGTGGACCGAGGTACACAGACGACGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail