Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9540
Gene name
LocationContig_7:64050..65866
Strand-
Gene length (bp)1816
Transcript length (bp)1623
Coding sequence length (bp)1623
Protein length (aa) 541

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00224 PK Pyruvate kinase, barrel domain 1.4E-169 45 390
PF02887 PK_C Pyruvate kinase, alpha/beta domain 8.8E-37 406 528

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P31865|KPYK_HYPJE Pyruvate kinase OS=Hypocrea jecorina GN=pki1 PE=3 SV=1 8 539 0.0E+00
sp|Q7RVA8|KPYK_NEUCR Pyruvate kinase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ace-8 PE=3 SV=1 14 540 0.0E+00
sp|Q12669|KPYK_ASPNG Pyruvate kinase OS=Aspergillus niger GN=pkiA PE=3 SV=1 15 539 0.0E+00
sp|P22360|KPYK_EMENI Pyruvate kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pkiA PE=3 SV=2 15 539 0.0E+00
sp|P46614|KPYK_CANAL Pyruvate kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC19 PE=1 SV=3 28 530 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P31865|KPYK_HYPJE Pyruvate kinase OS=Hypocrea jecorina GN=pki1 PE=3 SV=1 8 539 0.0E+00
sp|Q7RVA8|KPYK_NEUCR Pyruvate kinase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ace-8 PE=3 SV=1 14 540 0.0E+00
sp|Q12669|KPYK_ASPNG Pyruvate kinase OS=Aspergillus niger GN=pkiA PE=3 SV=1 15 539 0.0E+00
sp|P22360|KPYK_EMENI Pyruvate kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pkiA PE=3 SV=2 15 539 0.0E+00
sp|P46614|KPYK_CANAL Pyruvate kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC19 PE=1 SV=3 28 530 0.0E+00
sp|P30614|KPYK_YARLI Pyruvate kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PYK1 PE=3 SV=3 28 528 0.0E+00
sp|Q6BS75|KPYK_DEBHA Pyruvate kinase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PYK1 PE=3 SV=1 28 530 0.0E+00
sp|Q875M9|KPYK_KLULA Pyruvate kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PYK1 PE=3 SV=1 27 528 0.0E+00
sp|Q875S4|KPYK_LACK1 Pyruvate kinase OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / CCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) GN=PYK1 PE=3 SV=1 27 528 0.0E+00
sp|Q10208|KPYK_SCHPO Pyruvate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pyk1 PE=1 SV=1 29 531 0.0E+00
sp|Q6FIS9|KPYK1_CANGA Pyruvate kinase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PYK1 PE=3 SV=1 27 530 0.0E+00
sp|Q6FV12|KPYK2_CANGA Pyruvate kinase 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PYK2 PE=3 SV=1 27 527 0.0E+00
sp|Q759A9|KPYK_ASHGO Pyruvate kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PYK1 PE=3 SV=1 27 528 0.0E+00
sp|P00549|KPYK1_YEAST Pyruvate kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC19 PE=1 SV=2 27 527 0.0E+00
sp|Q875Z9|KPYK_NAUCC Pyruvate kinase OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=PYK1 PE=3 SV=1 43 530 0.0E+00
sp|P52489|KPYK2_YEAST Pyruvate kinase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PYK2 PE=1 SV=1 27 527 0.0E+00
sp|O94122|KPYK_AGABI Pyruvate kinase OS=Agaricus bisporus GN=pkiA PE=2 SV=1 27 540 0.0E+00
sp|Q92122|KPYM_XENLA Pyruvate kinase PKM OS=Xenopus laevis GN=pkm PE=2 SV=1 45 528 4.0E-172
sp|P14618|KPYM_HUMAN Pyruvate kinase PKM OS=Homo sapiens GN=PKM PE=1 SV=4 39 528 7.0E-171
sp|P11980|KPYM_RAT Pyruvate kinase PKM OS=Rattus norvegicus GN=Pkm PE=1 SV=3 28 528 4.0E-170
sp|P11974|KPYM_RABIT Pyruvate kinase PKM OS=Oryctolagus cuniculus GN=PKM PE=1 SV=4 28 528 5.0E-169
sp|Q5NVN0|KPYM_PONAB Pyruvate kinase PKM OS=Pongo abelii GN=PKM PE=2 SV=3 39 528 9.0E-169
sp|P00548|KPYM_CHICK Pyruvate kinase PKM OS=Gallus gallus GN=PKM PE=2 SV=2 45 528 3.0E-168
sp|P11979|KPYM_FELCA Pyruvate kinase PKM OS=Felis catus GN=PKM PE=1 SV=2 39 528 5.0E-168
sp|O62619|KPYK_DROME Pyruvate kinase OS=Drosophila melanogaster GN=PyK PE=2 SV=2 39 531 3.0E-165
sp|P52480|KPYM_MOUSE Pyruvate kinase PKM OS=Mus musculus GN=Pkm PE=1 SV=4 28 528 1.0E-164
sp|Q29536|KPYR_CANLF Pyruvate kinase PKLR OS=Canis lupus familiaris GN=PKLR PE=2 SV=2 45 528 5.0E-163
sp|P12928|KPYR_RAT Pyruvate kinase PKLR OS=Rattus norvegicus GN=Pklr PE=1 SV=2 45 528 4.0E-162
sp|P53657|KPYR_MOUSE Pyruvate kinase PKLR OS=Mus musculus GN=Pklr PE=1 SV=1 45 528 5.0E-162
sp|P30613|KPYR_HUMAN Pyruvate kinase PKLR OS=Homo sapiens GN=PKLR PE=1 SV=2 45 528 1.0E-161
sp|Q27686|KPYK_LEIME Pyruvate kinase OS=Leishmania mexicana GN=PYK PE=1 SV=2 38 528 1.0E-157
sp|P30615|KPYK1_TRYBB Pyruvate kinase 1 OS=Trypanosoma brucei brucei GN=PYK1 PE=1 SV=1 38 528 8.0E-151
sp|P30616|KPYK2_TRYBB Pyruvate kinase 2 OS=Trypanosoma brucei brucei GN=PYK2 PE=3 SV=1 38 528 7.0E-150
sp|Q27788|KPYK_TRYBO Pyruvate kinase OS=Trypanoplasma borreli GN=PYK PE=3 SV=1 38 528 2.0E-145
sp|Q54RF5|KPYK_DICDI Pyruvate kinase OS=Dictyostelium discoideum GN=pyk PE=1 SV=1 33 528 3.0E-136
sp|O44006|KPYK_EIMTE Pyruvate kinase OS=Eimeria tenella GN=PYK PE=2 SV=1 45 528 1.0E-135
sp|Q42806|KPYC_SOYBN Pyruvate kinase, cytosolic isozyme OS=Glycine max PE=2 SV=1 46 513 2.0E-127
sp|O65595|KPYC_ARATH Probable pyruvate kinase, cytosolic isozyme OS=Arabidopsis thaliana GN=At4g26390 PE=3 SV=1 46 512 2.0E-126
sp|Q42954|KPYC_TOBAC Pyruvate kinase, cytosolic isozyme OS=Nicotiana tabacum PE=2 SV=1 46 528 1.0E-124
sp|P22200|KPYC_SOLTU Pyruvate kinase, cytosolic isozyme OS=Solanum tuberosum PE=2 SV=1 46 513 5.0E-122
sp|Q02499|KPYK_GEOSE Pyruvate kinase OS=Geobacillus stearothermophilus GN=pyk PE=1 SV=2 45 527 5.0E-119
sp|P80885|KPYK_BACSU Pyruvate kinase OS=Bacillus subtilis (strain 168) GN=pyk PE=1 SV=2 44 527 2.0E-118
sp|P51181|KPYK_BACLI Pyruvate kinase OS=Bacillus licheniformis GN=pyk PE=3 SV=1 44 527 1.0E-116
sp|Q8Z6K2|KPYK1_SALTI Pyruvate kinase I OS=Salmonella typhi GN=pykF PE=3 SV=1 45 524 6.0E-116
sp|P77983|KPYK1_SALTY Pyruvate kinase I OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=pykF PE=3 SV=2 45 524 7.0E-116
sp|P0AD61|KPYK1_ECOLI Pyruvate kinase I OS=Escherichia coli (strain K12) GN=pykF PE=1 SV=1 45 524 2.0E-115
sp|P0AD62|KPYK1_ECO57 Pyruvate kinase I OS=Escherichia coli O157:H7 GN=pykF PE=3 SV=1 45 524 2.0E-115
sp|O08309|KPYK_CLOAB Pyruvate kinase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=pyk PE=3 SV=2 45 527 5.0E-115
sp|P51182|KPYK_SPOPS Pyruvate kinase OS=Sporosarcina psychrophila GN=pyk PE=3 SV=1 45 527 4.0E-111
sp|Q49YC7|KPYK_STAS1 Pyruvate kinase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=pyk PE=3 SV=1 45 527 8.0E-110
sp|Q6GG09|KPYK_STAAR Pyruvate kinase OS=Staphylococcus aureus (strain MRSA252) GN=pyk PE=1 SV=1 45 527 2.0E-108
sp|Q8CS69|KPYK_STAES Pyruvate kinase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=pyk PE=3 SV=1 45 527 4.0E-108
sp|Q5HNK7|KPYK_STAEQ Pyruvate kinase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=pyk PE=3 SV=1 45 527 4.0E-108
sp|Q2YTE3|KPYK_STAAB Pyruvate kinase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=pyk PE=3 SV=1 45 527 5.0E-108
sp|Q7A0N4|KPYK_STAAW Pyruvate kinase OS=Staphylococcus aureus (strain MW2) GN=pyk PE=3 SV=1 45 527 2.0E-107
sp|Q6G8M9|KPYK_STAAS Pyruvate kinase OS=Staphylococcus aureus (strain MSSA476) GN=pyk PE=3 SV=1 45 527 2.0E-107
sp|Q7A559|KPYK_STAAN Pyruvate kinase OS=Staphylococcus aureus (strain N315) GN=pyk PE=1 SV=1 45 527 2.0E-107
sp|Q99TG5|KPYK_STAAM Pyruvate kinase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=pyk PE=3 SV=1 45 527 2.0E-107
sp|Q5HF76|KPYK_STAAC Pyruvate kinase OS=Staphylococcus aureus (strain COL) GN=pyk PE=3 SV=1 45 527 2.0E-107
sp|Q2FXM9|KPYK_STAA8 Pyruvate kinase OS=Staphylococcus aureus (strain NCTC 8325) GN=pyk PE=3 SV=1 45 527 2.0E-107
sp|Q2FG40|KPYK_STAA3 Pyruvate kinase OS=Staphylococcus aureus (strain USA300) GN=pyk PE=3 SV=1 45 527 2.0E-107
sp|Q4L739|KPYK_STAHJ Pyruvate kinase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=pyk PE=3 SV=1 45 527 1.0E-103
sp|P34038|KPYK_LACDE Pyruvate kinase OS=Lactobacillus delbrueckii subsp. bulgaricus GN=pyk PE=1 SV=3 45 527 3.0E-100
sp|Q46289|KPYK_CLOPE Pyruvate kinase OS=Clostridium perfringens (strain 13 / Type A) GN=pykF PE=3 SV=2 45 527 5.0E-99
sp|Q9PK61|KPYK_CHLMU Pyruvate kinase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=pyk PE=3 SV=1 46 527 3.0E-95
sp|B0B7Q0|KPYK_CHLT2 Pyruvate kinase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=pyk PE=3 SV=1 46 527 1.0E-91
sp|P73534|KPYK2_SYNY3 Pyruvate kinase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pyk2 PE=3 SV=1 45 527 1.0E-91
sp|Q9Z984|KPYK_CHLPN Pyruvate kinase OS=Chlamydia pneumoniae GN=pyk PE=3 SV=1 46 473 1.0E-91
sp|P0CE21|KPYK_CHLTR Pyruvate kinase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=pyk PE=3 SV=1 46 527 2.0E-91
sp|Q55863|KPYK1_SYNY3 Pyruvate kinase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pyk1 PE=3 SV=1 45 529 1.0E-89
sp|Q8SQP0|KPYK_ENCCU Pyruvate kinase OS=Encephalitozoon cuniculi (strain GB-M1) GN=PYK1 PE=1 SV=2 47 467 1.0E-85
sp|Q2RAK2|KPYC1_ORYSJ Pyruvate kinase 1, cytosolic OS=Oryza sativa subsp. japonica GN=Os11g0148500 PE=1 SV=1 31 531 4.0E-85
sp|B8BJ39|KPYC1_ORYSI Pyruvate kinase 1, cytosolic OS=Oryza sativa subsp. indica GN=OsI_35105 PE=3 SV=1 31 531 4.0E-85
sp|Q9WY51|KPYK_THEMA Pyruvate kinase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=pyk PE=1 SV=1 45 531 6.0E-85
sp|Q2QXR8|KPYC2_ORYSJ Pyruvate kinase 2, cytosolic OS=Oryza sativa subsp. japonica GN=Os12g0145700 PE=2 SV=1 31 531 8.0E-85
sp|B8BM17|KPYC2_ORYSI Pyruvate kinase 2, cytosolic OS=Oryza sativa subsp. indica GN=OsI_37456 PE=3 SV=1 31 531 8.0E-85
sp|Q9FLW9|PKP2_ARATH Plastidial pyruvate kinase 2 OS=Arabidopsis thaliana GN=PKP2 PE=1 SV=1 45 513 9.0E-85
sp|Q44473|KPYK2_AGRVI Pyruvate kinase OS=Agrobacterium vitis GN=ttuE PE=2 SV=1 42 529 1.0E-84
sp|P9WKE5|KPYK_MYCTU Pyruvate kinase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pyk PE=1 SV=1 45 529 2.0E-82
sp|P9WKE4|KPYK_MYCTO Pyruvate kinase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pyk PE=3 SV=1 45 529 2.0E-82
sp|O51323|KPYK_BORBU Pyruvate kinase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=pyk PE=3 SV=1 45 469 6.0E-82
sp|P70789|KPYK1_AGRVI Pyruvate kinase OS=Agrobacterium vitis GN=ttuE PE=2 SV=1 42 530 6.0E-82
sp|Q46078|KPYK_CORGL Pyruvate kinase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=pyk PE=1 SV=1 45 527 9.0E-82
sp|Q40546|KPYG_TOBAC Pyruvate kinase isozyme G, chloroplastic OS=Nicotiana tabacum PE=2 SV=1 45 514 3.0E-81
sp|Q8FP04|KPYK_COREF Pyruvate kinase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=pyk PE=3 SV=2 45 527 1.0E-80
sp|Q07637|KPYK_LACLA Pyruvate kinase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=pyk PE=3 SV=2 45 527 2.0E-80
sp|Q93Z53|PKP3_ARATH Plastidial pyruvate kinase 3, chloroplastic OS=Arabidopsis thaliana GN=PKP3 PE=1 SV=1 35 478 2.0E-79
sp|P94939|KPYK_MYCIT Pyruvate kinase OS=Mycobacterium intracellulare GN=pyk PE=3 SV=1 45 529 6.0E-79
sp|Q8ZNW0|KPYK2_SALTY Pyruvate kinase II OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=pykA PE=3 SV=3 42 528 1.0E-78
sp|O05118|KPYK_METEA Pyruvate kinase OS=Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) GN=pyk PE=3 SV=2 42 534 3.0E-78
sp|P21599|KPYK2_ECOLI Pyruvate kinase II OS=Escherichia coli (strain K12) GN=pykA PE=1 SV=3 42 528 2.0E-77
sp|P43924|KPYK_HAEIN Pyruvate kinase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=pykA PE=3 SV=2 42 528 4.0E-77
sp|Q89AI8|KPYK_BUCBP Pyruvate kinase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=pykA PE=3 SV=1 42 529 2.0E-76
sp|Q8K9M3|KPYK_BUCAP Pyruvate kinase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=pykA PE=3 SV=1 45 529 2.0E-75
sp|P57404|KPYK_BUCAI Pyruvate kinase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=pykA PE=3 SV=1 45 529 2.0E-74
sp|P32044|KPYK_THEAC Pyruvate kinase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=Ta0896 PE=1 SV=2 46 507 6.0E-73
sp|Q9LIK0|PKP1_ARATH Plastidial pyruvate kinase 1, chloroplastic OS=Arabidopsis thaliana GN=PKP1 PE=1 SV=1 42 512 2.0E-72
sp|Q43117|KPYA_RICCO Pyruvate kinase isozyme A, chloroplastic OS=Ricinus communis PE=1 SV=1 42 468 1.0E-71
sp|Q40545|KPYA_TOBAC Pyruvate kinase isozyme A, chloroplastic OS=Nicotiana tabacum PE=2 SV=1 42 468 2.0E-69
sp|Q56301|KPYK_THELN Pyruvate kinase OS=Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) GN=pki PE=3 SV=2 46 529 9.0E-66
sp|P55964|KPYG_RICCO Pyruvate kinase isozyme G, chloroplastic (Fragment) OS=Ricinus communis PE=2 SV=1 105 479 1.0E-65
sp|P47458|KPYK_MYCGE Pyruvate kinase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=pyk PE=3 SV=1 45 387 6.0E-63
sp|P78031|KPYK_MYCPN Pyruvate kinase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=pyk PE=3 SV=1 45 387 3.0E-61
sp|Q57572|KPYK_METJA Pyruvate kinase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0108 PE=3 SV=1 45 480 5.0E-61
sp|Q9YEU2|KPYK_AERPE Pyruvate kinase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pyk PE=1 SV=1 49 468 2.0E-54
sp|O30853|KPYK1_PHOLE Pyruvate kinase I (Fragment) OS=Photobacterium leiognathi GN=pki PE=3 SV=1 283 527 2.0E-47
sp|Q8ZYE0|KPYK_PYRAE Pyruvate kinase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=pyk PE=1 SV=1 50 519 1.0E-45
sp|Q9M3B6|PKP4_ARATH Plastidial pyruvate kinase 4, chloroplastic OS=Arabidopsis thaliana GN=PKP4 PE=2 SV=1 163 371 1.0E-27
sp|Q04668|KPYK_LEIBR Pyruvate kinase (Fragment) OS=Leishmania braziliensis PE=2 SV=1 48 119 8.0E-22
sp|P19680|KPYK_SPICI Pyruvate kinase (Fragment) OS=Spiroplasma citri GN=pyk PE=3 SV=1 45 117 1.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0004743 pyruvate kinase activity Yes
GO:0006096 glycolytic process Yes
GO:0030955 potassium ion binding Yes
GO:0000287 magnesium ion binding Yes
GO:1901564 organonitrogen compound metabolic process No
GO:0019693 ribose phosphate metabolic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0043167 ion binding No
GO:0032787 monocarboxylic acid metabolic process No
GO:0006090 pyruvate metabolic process No
GO:0006165 nucleoside diphosphate phosphorylation No
GO:0006082 organic acid metabolic process No
GO:0006754 ATP biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0072524 pyridine-containing compound metabolic process No
GO:0009259 ribonucleotide metabolic process No
GO:0071704 organic substance metabolic process No
GO:0046034 ATP metabolic process No
GO:0034404 nucleobase-containing small molecule biosynthetic process No
GO:0019362 pyridine nucleotide metabolic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0006732 coenzyme metabolic process No
GO:0009108 coenzyme biosynthetic process No
GO:0043169 cation binding No
GO:0008150 biological_process No
GO:0046483 heterocycle metabolic process No
GO:0006753 nucleoside phosphate metabolic process No
GO:0046434 organophosphate catabolic process No
GO:0003674 molecular_function No
GO:0019438 aromatic compound biosynthetic process No
GO:0009141 nucleoside triphosphate metabolic process No
GO:0009206 purine ribonucleoside triphosphate biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0009056 catabolic process No
GO:0009165 nucleotide biosynthetic process No
GO:0009152 purine ribonucleotide biosynthetic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0046031 ADP metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0031420 alkali metal ion binding No
GO:0044283 small molecule biosynthetic process No
GO:0090407 organophosphate biosynthetic process No
GO:0072522 purine-containing compound biosynthetic process No
GO:0009117 nucleotide metabolic process No
GO:0008152 metabolic process No
GO:0044248 cellular catabolic process No
GO:0006163 purine nucleotide metabolic process No
GO:0009135 purine nucleoside diphosphate metabolic process No
GO:0016053 organic acid biosynthetic process No
GO:0016052 carbohydrate catabolic process No
GO:0019439 aromatic compound catabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0034655 nucleobase-containing compound catabolic process No
GO:0009260 ribonucleotide biosynthetic process No
GO:0046939 nucleotide phosphorylation No
GO:0009166 nucleotide catabolic process No
GO:0072330 monocarboxylic acid biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0009179 purine ribonucleoside diphosphate metabolic process No
GO:1901361 organic cyclic compound catabolic process No
GO:0019637 organophosphate metabolic process No
GO:0009199 ribonucleoside triphosphate metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0046700 heterocycle catabolic process No
GO:0009185 ribonucleoside diphosphate metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0046394 carboxylic acid biosynthetic process No
GO:0009144 purine nucleoside triphosphate metabolic process No
GO:0009145 purine nucleoside triphosphate biosynthetic process No
GO:1901293 nucleoside phosphate biosynthetic process No
GO:0019359 nicotinamide nucleotide biosynthetic process No
GO:1901292 nucleoside phosphate catabolic process No
GO:0006733 oxidoreduction coenzyme metabolic process No
GO:0016310 phosphorylation No
GO:0009987 cellular process No
GO:0051186 cofactor metabolic process No
GO:0044281 small molecule metabolic process No
GO:0009150 purine ribonucleotide metabolic process No
GO:0006091 generation of precursor metabolites and energy No
GO:0003824 catalytic activity No
GO:0044249 cellular biosynthetic process No
GO:0009142 nucleoside triphosphate biosynthetic process No
GO:0009132 nucleoside diphosphate metabolic process No
GO:0072525 pyridine-containing compound biosynthetic process No
GO:0006164 purine nucleotide biosynthetic process No
GO:0072521 purine-containing compound metabolic process No
GO:0009058 biosynthetic process No
GO:0042866 pyruvate biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0009201 ribonucleoside triphosphate biosynthetic process No
GO:0006757 ATP generation from ADP No
GO:0046390 ribose phosphate biosynthetic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0051188 cofactor biosynthetic process No
GO:0009205 purine ribonucleoside triphosphate metabolic process No
GO:0019363 pyridine nucleotide biosynthetic process No
GO:0005975 carbohydrate metabolic process No
GO:0005488 binding No
GO:0044238 primary metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0046872 metal ion binding No
GO:0017144 drug metabolic process No
GO:0044270 cellular nitrogen compound catabolic process No
GO:0016740 transferase activity No
GO:0046496 nicotinamide nucleotide metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:1901575 organic substance catabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9540
MAQNPNRSRSFSVMAAAQQDHLNGGGRIKWLASLDTAYSPERNYRRSSIICTIGPKTNSVDAINSLRDAGLNVVR
MNFSHGSYEYHQSVIDNARAAVDAHPGRPVAIALDTKGPEIRTGNTNNDEDLPISAGTVMNITTDEKYATSCDTA
NMYVDYKNITRVIKPGRIIYVDDGVLAFDVLAIKDEKNIEVRARNNGFISSRKGVNLPNTDVDLPALSEKDKADL
QFGVKNKVDMVFASFIRRAQDIRDIRKVLGDEGKGIQIIAKIENRQGLNNFQEILDETDGVMVARGDLGIEIPAA
EVFAAQKKLIAMCNMAGKPVICATQMLESMIKNPRPTRAEISDVGNAITDGADCVMLSGETAKGSYPVEAVREMH
EACLKAENSIPYVSHFEEMCTLVKRPVQTVESCAMAAVRASLDLGAGGIIVLSTSGESARLLSKYRPVCPIFMVT
RNATTSRFSHLYRGVYPFLFPEAKPDFEKVNWQEDVDKRIKWAVNHALQLKTLTPGDTVVVVQGWKGGMGNTNTL
RIVRADPEHLGIGQP*
Coding >Hirsu2|9540
ATGGCCCAGAATCCCAACCGCTCCCGCTCATTTAGCGTCATGGCCGCTGCTCAGCAGGACCATCTCAACGGCGGC
GGTCGCATCAAGTGGCTGGCCTCGCTCGACACCGCCTACAGCCCGGAGCGCAACTACCGCCGCTCCTCCATCATC
TGCACCATCGGCCCCAAGACCAACTCGGTCGACGCCATCAACAGTCTCCGCGATGCCGGCCTCAACGTCGTCCGC
ATGAACTTCTCCCACGGCTCCTACGAGTACCACCAGTCCGTCATTGACAATGCCCGCGCCGCCGTCGACGCCCAC
CCCGGCCGTCCAGTCGCCATCGCCCTCGACACAAAGGGCCCCGAGATTCGCACCGGCAACACCAACAACGACGAG
GATCTCCCCATCAGCGCCGGCACCGTCATGAACATCACCACCGACGAGAAATACGCCACCTCGTGCGACACTGCC
AACATGTACGTCGACTACAAGAACATCACGAGGGTCATCAAGCCAGGCCGCATCATCTACGTCGACGACGGCGTT
CTCGCCTTTGACGTCCTCGCCATCAAGGACGAGAAGAACATCGAGGTCCGGGCCCGAAACAACGGCTTCATCTCG
TCTCGCAAAGGCGTCAATTTGCCCAACACGGATGTCGACCTCCCAGCCCTGTCGGAGAAGGACAAGGCCGACCTC
CAATTCGGCGTTAAGAACAAGGTTGACATGGTCTTCGCCTCGTTTATCCGTCGCGCCCAGGACATTCGCGACATC
CGCAAGGTGCTGGGCGACGAGGGCAAGGGCATCCAGATCATTGCCAAGATCGAGAACCGACAAGGACTCAACAAC
TTCCAGGAGATCCTCGACGAGACGGACGGTGTCATGGTCGCCCGCGGTGACCTCGGCATCGAGATCCCGGCTGCC
GAGGTGTTTGCGGCCCAGAAGAAGCTCATCGCCATGTGCAACATGGCCGGCAAGCCCGTCATCTGCGCCACTCAG
ATGCTCGAGTCGATGATCAAGAACCCGCGTCCCACCCGGGCCGAGATCAGTGACGTTGGCAACGCCATCACCGAC
GGGGCGGACTGTGTCATGCTCTCGGGCGAGACGGCCAAGGGCAGCTACCCCGTCGAGGCCGTCCGCGAGATGCAC
GAGGCCTGCCTCAAGGCCGAGAACTCGATCCCGTACGTCTCCCACTTCGAGGAGATGTGCACCCTGGTCAAGCGT
CCGGTGCAGACGGTCGAGTCGTGCGCCATGGCCGCCGTCCGCGCGTCGCTCGACCTCGGAGCCGGCGGCATCATC
GTCCTGTCGACGTCGGGCGAGTCGGCCAGGCTGCTGTCCAAGTACCGGCCCGTCTGCCCCATCTTCATGGTGACG
CGCAACGCGACGACTTCGCGCTTCAGCCACCTGTACCGCGGCGTCTACCCGTTCCTCTTCCCCGAGGCCAAGCCC
GACTTCGAAAAGGTCAACTGGCAGGAGGACGTGGACAAGCGCATCAAGTGGGCCGTCAACCACGCGCTGCAGCTC
AAGACGCTGACGCCCGGCGACACTGTCGTCGTCGTGCAGGGCTGGAAGGGTGGCATGGGCAACACCAACACGCTC
CGCATCGTGCGAGCGGACCCGGAGCACCTCGGCATCGGGCAGCCTTGA
Transcript >Hirsu2|9540
ATGGCCCAGAATCCCAACCGCTCCCGCTCATTTAGCGTCATGGCCGCTGCTCAGCAGGACCATCTCAACGGCGGC
GGTCGCATCAAGTGGCTGGCCTCGCTCGACACCGCCTACAGCCCGGAGCGCAACTACCGCCGCTCCTCCATCATC
TGCACCATCGGCCCCAAGACCAACTCGGTCGACGCCATCAACAGTCTCCGCGATGCCGGCCTCAACGTCGTCCGC
ATGAACTTCTCCCACGGCTCCTACGAGTACCACCAGTCCGTCATTGACAATGCCCGCGCCGCCGTCGACGCCCAC
CCCGGCCGTCCAGTCGCCATCGCCCTCGACACAAAGGGCCCCGAGATTCGCACCGGCAACACCAACAACGACGAG
GATCTCCCCATCAGCGCCGGCACCGTCATGAACATCACCACCGACGAGAAATACGCCACCTCGTGCGACACTGCC
AACATGTACGTCGACTACAAGAACATCACGAGGGTCATCAAGCCAGGCCGCATCATCTACGTCGACGACGGCGTT
CTCGCCTTTGACGTCCTCGCCATCAAGGACGAGAAGAACATCGAGGTCCGGGCCCGAAACAACGGCTTCATCTCG
TCTCGCAAAGGCGTCAATTTGCCCAACACGGATGTCGACCTCCCAGCCCTGTCGGAGAAGGACAAGGCCGACCTC
CAATTCGGCGTTAAGAACAAGGTTGACATGGTCTTCGCCTCGTTTATCCGTCGCGCCCAGGACATTCGCGACATC
CGCAAGGTGCTGGGCGACGAGGGCAAGGGCATCCAGATCATTGCCAAGATCGAGAACCGACAAGGACTCAACAAC
TTCCAGGAGATCCTCGACGAGACGGACGGTGTCATGGTCGCCCGCGGTGACCTCGGCATCGAGATCCCGGCTGCC
GAGGTGTTTGCGGCCCAGAAGAAGCTCATCGCCATGTGCAACATGGCCGGCAAGCCCGTCATCTGCGCCACTCAG
ATGCTCGAGTCGATGATCAAGAACCCGCGTCCCACCCGGGCCGAGATCAGTGACGTTGGCAACGCCATCACCGAC
GGGGCGGACTGTGTCATGCTCTCGGGCGAGACGGCCAAGGGCAGCTACCCCGTCGAGGCCGTCCGCGAGATGCAC
GAGGCCTGCCTCAAGGCCGAGAACTCGATCCCGTACGTCTCCCACTTCGAGGAGATGTGCACCCTGGTCAAGCGT
CCGGTGCAGACGGTCGAGTCGTGCGCCATGGCCGCCGTCCGCGCGTCGCTCGACCTCGGAGCCGGCGGCATCATC
GTCCTGTCGACGTCGGGCGAGTCGGCCAGGCTGCTGTCCAAGTACCGGCCCGTCTGCCCCATCTTCATGGTGACG
CGCAACGCGACGACTTCGCGCTTCAGCCACCTGTACCGCGGCGTCTACCCGTTCCTCTTCCCCGAGGCCAAGCCC
GACTTCGAAAAGGTCAACTGGCAGGAGGACGTGGACAAGCGCATCAAGTGGGCCGTCAACCACGCGCTGCAGCTC
AAGACGCTGACGCCCGGCGACACTGTCGTCGTCGTGCAGGGCTGGAAGGGTGGCATGGGCAACACCAACACGCTC
CGCATCGTGCGAGCGGACCCGGAGCACCTCGGCATCGGGCAGCCTTGA
Gene >Hirsu2|9540
ATGGCCCAGAATCCCAACCGCTCCCGCTCATTTAGCGTCATGGCCGCTGCTCAGCAGGACCATCTCAACGGCGGC
GGTCGCATCAAGTGGCTGGCCTCGCTCGACACCGCCTACAGCCCGGAGCGCAACTACCGCCGCTCCTCCATCATC
TGCACCATCGGCCCCAAGACCAACTCGGTCGACGCCATCAACAGTCTCCGCGATGCCGGCCTCAACGTCGTCCGC
ATGAACTTCTCCCACGGCTCCTACGAGTACCACCAGTCCGTCATTGACAATGCCCGCGCCGCCGTCGACGCCCAC
CCCGGCCGTCCAGTCGCCATCGCCCTCGACACAAAGGGCCCCGAGATTCGCACCGGCAACACCAACAACGACGAG
GATCTCCCCATCAGCGCCGGCACCGTCATGAACATCACCACCGACGAGAAATACGCCACCTCGTGCGACACTGCC
AACATGTGAGTCCTGTGCCTGTGCCGCAAACTCGCGCCTATGCCTCCGGCTGTCCGTCCTTGCCGCTGCGCTGTT
GGGCGGCGGCCGAATAGTTCCCCCCTTCCCCCCCCTCCCCCCCCTTCTCCCCCACTGACTTCCGGTTGGTCGGCT
GCTGTACCCCCCGACTGGCTGCTGACCGTTGTCGCCGCATACATGCAGGTACGTCGACTACAAGAACATCACGAG
GGTCATCAAGCCAGGCCGCATCATCTACGTCGACGACGGCGTTCTCGCCTTTGACGTCCTCGCCATCAAGGACGA
GAAGAACATCGAGGTCCGGGCCCGAAACAACGGCTTCATCTCGTCTCGCAAAGGCGTCAATTTGCCCAACACGGA
TGTCGACCTCCCAGCCCTGTCGGAGAAGGACAAGGCCGACCTCCAATTCGGCGTTAAGAACAAGGTTGACATGGT
CTTCGCCTCGTTTATCCGTCGCGCCCAGGACATTCGCGACATCCGCAAGGTGCTGGGCGACGAGGGCAAGGGCAT
CCAGATCATTGCCAAGATCGAGAACCGACAAGGACTCAACAACTTCCAGGAGATCCTCGACGAGACGGACGGTGT
CATGGTCGCCCGCGGTGACCTCGGCATCGAGATCCCGGCTGCCGAGGTGTTTGCGGCCCAGAAGAAGCTCATCGC
CATGTGCAACATGGCCGGCAAGCCCGTCATCTGCGCCACTCAGATGCTCGAGTCGATGATCAAGAACCCGCGTCC
CACCCGGGCCGAGATCAGTGACGTTGGCAACGCCATCACCGACGGGGCGGACTGTGTCATGCTCTCGGGCGAGAC
GGCCAAGGGCAGCTACCCCGTCGAGGCCGTCCGCGAGATGCACGAGGCCTGCCTCAAGGCCGAGAACTCGATCCC
GTACGTCTCCCACTTCGAGGAGATGTGCACCCTGGTCAAGCGTCCGGTGCAGACGGTCGAGTCGTGCGCCATGGC
CGCCGTCCGCGCGTCGCTCGACCTCGGAGCCGGCGGCATCATCGTCCTGTCGACGTCGGGCGAGTCGGCCAGGCT
GCTGTCCAAGTACCGGCCCGTCTGCCCCATCTTCATGGTGACGCGCAACGCGACGACTTCGCGCTTCAGCCACCT
GTACCGCGGCGTCTACCCGTTCCTCTTCCCCGAGGCCAAGCCCGACTTCGAAAAGGTCAACTGGCAGGAGGACGT
GGACAAGCGCATCAAGTGGGCCGTCAACCACGCGCTGCAGCTCAAGACGCTGACGCCCGGCGACACTGTCGTCGT
CGTGCAGGGCTGGAAGGGTGGCATGGGCAACACCAACACGCTCCGCATCGTGCGAGCGGACCCGGAGCACCTCGG
CATCGGGCAGCCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail