Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9539
Gene name
LocationContig_7:61266..63110
Strand-
Gene length (bp)1844
Transcript length (bp)1671
Coding sequence length (bp)1671
Protein length (aa) 557

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 6.4E-44 151 461
PF07714 Pkinase_Tyr Protein tyrosine kinase 9.1E-31 154 460

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q54RJ4|IKSA_DICDI Probable serine/threonine-protein kinase iksA OS=Dictyostelium discoideum GN=iksA PE=3 SV=1 145 461 2.0E-54
sp|P47042|IKS1_YEAST Probable serine/threonine-protein kinase IKS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IKS1 PE=1 SV=1 139 460 2.0E-47
sp|Q9QYZ3|SMK2B_MOUSE Sperm motility kinase 2B OS=Mus musculus GN=Smok2b PE=2 SV=1 146 462 3.0E-21
sp|Q9QYZ4|SMOK1_MOUSE Sperm motility kinase 1 OS=Mus musculus GN=Smok1 PE=2 SV=1 144 462 2.0E-20
sp|Q6P3R8|NEK5_HUMAN Serine/threonine-protein kinase Nek5 OS=Homo sapiens GN=NEK5 PE=2 SV=1 156 461 4.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q54RJ4|IKSA_DICDI Probable serine/threonine-protein kinase iksA OS=Dictyostelium discoideum GN=iksA PE=3 SV=1 145 461 2.0E-54
sp|P47042|IKS1_YEAST Probable serine/threonine-protein kinase IKS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IKS1 PE=1 SV=1 139 460 2.0E-47
sp|Q9QYZ3|SMK2B_MOUSE Sperm motility kinase 2B OS=Mus musculus GN=Smok2b PE=2 SV=1 146 462 3.0E-21
sp|Q9QYZ4|SMOK1_MOUSE Sperm motility kinase 1 OS=Mus musculus GN=Smok1 PE=2 SV=1 144 462 2.0E-20
sp|Q6P3R8|NEK5_HUMAN Serine/threonine-protein kinase Nek5 OS=Homo sapiens GN=NEK5 PE=2 SV=1 156 461 4.0E-20
sp|Q63184|E2AK2_RAT Interferon-induced, double-stranded RNA-activated protein kinase OS=Rattus norvegicus GN=Eif2ak2 PE=1 SV=1 156 470 6.0E-20
sp|Q7RAH3|CDPK1_PLAYO Calcium-dependent protein kinase 1 OS=Plasmodium yoelii yoelii GN=CPK1 PE=3 SV=3 156 511 7.0E-20
sp|Q2MHE4|HT1_ARATH Serine/threonine-protein kinase HT1 OS=Arabidopsis thaliana GN=HT1 PE=1 SV=1 199 464 1.0E-19
sp|Q03963|E2AK2_MOUSE Interferon-induced, double-stranded RNA-activated protein kinase OS=Mus musculus GN=Eif2ak2 PE=1 SV=2 146 389 1.0E-19
sp|Q6RET6|CCAMK_PEA Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase (Fragment) OS=Pisum sativum GN=SYM9 PE=1 SV=2 300 461 2.0E-19
sp|Q9QYZ6|SMK2A_MOUSE Sperm motility kinase 2A OS=Mus musculus GN=Smok2a PE=2 SV=1 155 462 2.0E-19
sp|P62343|CDPK1_PLAFK Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK1 PE=1 SV=2 156 511 4.0E-19
sp|P62344|CDPK1_PLAF7 Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate 3D7) GN=CPK1 PE=3 SV=2 156 511 4.0E-19
sp|P25323|MYLKA_DICDI Myosin light chain kinase A OS=Dictyostelium discoideum GN=mlkA PE=1 SV=2 150 461 5.0E-19
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 156 485 5.0E-19
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 155 461 1.0E-18
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 155 461 1.0E-18
sp|Q9QYZ5|SMK3_MOUSE Sperm motility kinase 3 OS=Mus musculus GN=Smok3a PE=2 SV=1 150 462 2.0E-18
sp|Q8C0X8|SMKX_MOUSE Sperm motility kinase X OS=Mus musculus PE=2 SV=1 136 539 2.0E-18
sp|P19525|E2AK2_HUMAN Interferon-induced, double-stranded RNA-activated protein kinase OS=Homo sapiens GN=EIF2AK2 PE=1 SV=2 146 461 3.0E-18
sp|P50526|SSP1_SCHPO Serine/threonine-protein kinase ssp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssp1 PE=1 SV=1 128 460 4.0E-18
sp|Q9C098|DCLK3_HUMAN Serine/threonine-protein kinase DCLK3 OS=Homo sapiens GN=DCLK3 PE=2 SV=2 199 485 7.0E-18
sp|P00521|ABL_MLVAB Tyrosine-protein kinase transforming protein Abl OS=Abelson murine leukemia virus GN=ABL PE=3 SV=1 165 497 7.0E-18
sp|P00520|ABL1_MOUSE Tyrosine-protein kinase ABL1 OS=Mus musculus GN=Abl1 PE=1 SV=3 165 497 8.0E-18
sp|Q07250|KCCS_MALDO Calcium/calmodulin-dependent serine/threonine-protein kinase OS=Malus domestica PE=2 SV=1 295 461 1.0E-17
sp|Q5ZJB4|IKKA_CHICK Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Gallus gallus GN=CHUK PE=2 SV=1 156 399 1.0E-17
sp|P54739|PKAA_STRCO Serine/threonine-protein kinase PkaA OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pkaA PE=3 SV=1 144 506 1.0E-17
sp|G5ECJ6|CSK1_CAEEL Tyrosine-protein kinase csk-1 OS=Caenorhabditis elegans GN=csk-1 PE=1 SV=1 193 461 2.0E-17
sp|Q8BWQ5|DCLK3_MOUSE Serine/threonine-protein kinase DCLK3 OS=Mus musculus GN=Dclk3 PE=2 SV=2 199 469 2.0E-17
sp|Q59W62|GIN4_CANAL Serine/threonine-protein kinase GIN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GIN4 PE=1 SV=1 155 461 3.0E-17
sp|P22517|KCC2_YEAST Calcium/calmodulin-dependent protein kinase II OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK2 PE=1 SV=2 147 461 3.0E-17
sp|A0AAR7|CCAMK_LOTJA Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Lotus japonicus GN=CCAMK PE=1 SV=1 295 461 3.0E-17
sp|Q6RET7|CCAMK_MEDTR Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase DMI-3 OS=Medicago truncatula GN=DMI3 PE=2 SV=1 300 461 5.0E-17
sp|P46551|CDK12_CAEEL Cyclin-dependent kinase 12 OS=Caenorhabditis elegans GN=cdk-12 PE=1 SV=4 118 461 6.0E-17
sp|P00519|ABL1_HUMAN Tyrosine-protein kinase ABL1 OS=Homo sapiens GN=ABL1 PE=1 SV=4 165 497 7.0E-17
sp|P27466|KCC1_YEAST Calcium/calmodulin-dependent protein kinase I OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK1 PE=1 SV=2 147 461 8.0E-17
sp|Q52EB3|ATG1_MAGO7 Serine/threonine-protein kinase ATG1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ATG1 PE=1 SV=1 150 549 9.0E-17
sp|A0JLX3|SMK4A_MOUSE Sperm motility kinase 4A OS=Mus musculus GN=Smok4a PE=2 SV=2 156 462 1.0E-16
sp|Q2H6X2|ATG1_CHAGB Serine/threonine-protein kinase ATG1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATG1 PE=3 SV=1 150 405 1.0E-16
sp|Q86IX1|DST1_DICDI Serine/threonine-protein kinase dst1 OS=Dictyostelium discoideum GN=dst1 PE=3 SV=1 156 461 1.0E-16
sp|P00541|FPS_AVISP Tyrosine-protein kinase transforming protein Fps OS=Avian sarcoma virus (strain PRCII) GN=V-FPS PE=3 SV=1 156 465 1.0E-16
sp|Q61UC4|KRAF1_CAEBR Raf homolog serine/threonine-protein kinase OS=Caenorhabditis briggsae GN=lin-45 PE=3 SV=2 150 465 1.0E-16
sp|Q7TSC3|NEK5_MOUSE Serine/threonine-protein kinase Nek5 OS=Mus musculus GN=Nek5 PE=2 SV=1 155 461 1.0E-16
sp|Q07292|KRAF1_CAEEL Raf homolog serine/threonine-protein kinase OS=Caenorhabditis elegans GN=lin-45 PE=1 SV=2 150 465 1.0E-16
sp|Q8W490|PEPK2_ARATH Serine/threonine-protein kinase PEPKR2 OS=Arabidopsis thaliana GN=PEPKR2 PE=2 SV=1 156 461 2.0E-16
sp|F4IRW0|ATG1C_ARATH Serine/threonine-protein kinase ATG1c OS=Arabidopsis thaliana GN=ATG1C PE=2 SV=1 141 502 2.0E-16
sp|O34507|PRKC_BACSU Serine/threonine-protein kinase PrkC OS=Bacillus subtilis (strain 168) GN=prkC PE=1 SV=1 155 472 3.0E-16
sp|P34244|HSL1_YEAST Probable serine/threonine-protein kinase HSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSL1 PE=1 SV=2 199 461 4.0E-16
sp|Q9CEF5|PKNB_LACLA Probable serine/threonine-protein kinase PknB OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=pknB PE=3 SV=1 156 471 4.0E-16
sp|Q43531|CCAMK_LILLO Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Lilium longiflorum GN=CCAMK PE=1 SV=1 176 461 7.0E-16
sp|P42683|LCK_CHICK Proto-oncogene tyrosine-protein kinase LCK OS=Gallus gallus GN=LCK PE=2 SV=2 287 456 7.0E-16
sp|Q8MYF1|Y2070_DICDI Probable serine/threonine-protein kinase DDB_G0277449 OS=Dictyostelium discoideum GN=DDB_G0277449 PE=3 SV=1 150 458 7.0E-16
sp|P51956|NEK3_HUMAN Serine/threonine-protein kinase Nek3 OS=Homo sapiens GN=NEK3 PE=1 SV=2 155 461 7.0E-16
sp|Q86I06|NEK3_DICDI Probable serine/threonine-protein kinase nek3 OS=Dictyostelium discoideum GN=nek3 PE=3 SV=1 150 461 8.0E-16
sp|P00530|FPS_FUJSV Tyrosine-protein kinase transforming protein Fps OS=Fujinami sarcoma virus GN=V-FPS PE=3 SV=1 156 465 1.0E-15
sp|Q76P07|Y7165_DICDI Probable serine/threonine-protein kinase DDB_G0277165 OS=Dictyostelium discoideum GN=DDB_G0277165 PE=3 SV=1 150 460 1.0E-15
sp|Q61846|MELK_MOUSE Maternal embryonic leucine zipper kinase OS=Mus musculus GN=Melk PE=1 SV=2 146 461 1.0E-15
sp|P06241|FYN_HUMAN Tyrosine-protein kinase Fyn OS=Homo sapiens GN=FYN PE=1 SV=3 194 456 1.0E-15
sp|Q62844|FYN_RAT Tyrosine-protein kinase Fyn OS=Rattus norvegicus GN=Fyn PE=1 SV=1 194 456 1.0E-15
sp|A0JNB0|FYN_BOVIN Tyrosine-protein kinase Fyn OS=Bos taurus GN=FYN PE=2 SV=1 194 456 1.0E-15
sp|A1Y2K1|FYN_PIG Tyrosine-protein kinase Fyn OS=Sus scrofa GN=FYN PE=2 SV=2 194 456 1.0E-15
sp|Q6EWH2|FYNA_DANRE Tyrosine-protein kinase fyna OS=Danio rerio GN=fyna PE=1 SV=2 288 456 1.0E-15
sp|P09769|FGR_HUMAN Tyrosine-protein kinase Fgr OS=Homo sapiens GN=FGR PE=1 SV=2 300 456 2.0E-15
sp|Q6CSX2|ATG1_KLULA Serine/threonine-protein kinase ATG1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATG1 PE=3 SV=1 153 554 2.0E-15
sp|Q6BS08|ATG1_DEBHA Serine/threonine-protein kinase ATG1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATG1 PE=3 SV=2 193 459 2.0E-15
sp|Q5A649|ATG1_CANAL Serine/threonine-protein kinase ATG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATG1 PE=3 SV=1 160 461 2.0E-15
sp|P27446|FYN_XIPHE Tyrosine-protein kinase Fyn OS=Xiphophorus helleri GN=fyn PE=2 SV=3 194 456 2.0E-15
sp|P53739|FPK1_YEAST Flippase kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FPK1 PE=1 SV=1 135 454 2.0E-15
sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens GN=MARK2 PE=1 SV=2 155 461 2.0E-15
sp|Q05512|MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus GN=Mark2 PE=1 SV=3 155 461 2.0E-15
sp|Q6AVM3|CCAMK_ORYSJ Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Oryza sativa subsp. japonica GN=CCAMK PE=2 SV=1 208 461 3.0E-15
sp|Q9R0A5|NEK3_MOUSE Serine/threonine-protein kinase Nek3 OS=Mus musculus GN=Nek3 PE=1 SV=2 155 461 3.0E-15
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 155 461 3.0E-15
sp|Q10GB1|NEK1_ORYSJ Serine/threonine-protein kinase Nek1 OS=Oryza sativa subsp. japonica GN=NEK1 PE=3 SV=1 156 461 3.0E-15
sp|Q14680|MELK_HUMAN Maternal embryonic leucine zipper kinase OS=Homo sapiens GN=MELK PE=1 SV=3 146 461 3.0E-15
sp|P51957|NEK4_HUMAN Serine/threonine-protein kinase Nek4 OS=Homo sapiens GN=NEK4 PE=1 SV=2 155 508 4.0E-15
sp|Q55CL6|MP2K1_DICDI Dual specificity mitogen-activated protein kinase kinase 1 OS=Dictyostelium discoideum GN=mekA PE=1 SV=1 155 403 4.0E-15
sp|F4JY37|RUK_ARATH Serine/threonine-protein kinase RUNKEL OS=Arabidopsis thaliana GN=RUK PE=1 SV=1 176 454 4.0E-15
sp|Q55A09|Y9963_DICDI Probable serine/threonine-protein kinase DDB_G0272254 OS=Dictyostelium discoideum GN=DDB_G0272254 PE=3 SV=1 180 460 4.0E-15
sp|Q54MH0|FHKD_DICDI Probable serine/threonine-protein kinase fhkD OS=Dictyostelium discoideum GN=fhkD PE=3 SV=1 199 461 5.0E-15
sp|F1RDG9|FYNB_DANRE Tyrosine-protein kinase fynb OS=Danio rerio GN=fynb PE=2 SV=1 288 456 5.0E-15
sp|Q4JIM5|ABL2_MOUSE Abelson tyrosine-protein kinase 2 OS=Mus musculus GN=Abl2 PE=1 SV=1 165 470 5.0E-15
sp|Q9SLI2|NEK1_ARATH Serine/threonine-protein kinase Nek1 OS=Arabidopsis thaliana GN=NEK1 PE=2 SV=2 150 461 5.0E-15
sp|P00544|FGR_FSVGR Tyrosine-protein kinase transforming protein Fgr OS=Feline sarcoma virus (strain Gardner-Rasheed) GN=V-FGR PE=3 SV=1 288 456 5.0E-15
sp|Q9U1Y5|CHK2_CAEEL Serine/threonine-protein kinase chk-2 OS=Caenorhabditis elegans GN=chk-2 PE=2 SV=2 147 461 6.0E-15
sp|P14234|FGR_MOUSE Tyrosine-protein kinase Fgr OS=Mus musculus GN=Fgr PE=1 SV=2 300 456 6.0E-15
sp|F4JBP3|ATG1B_ARATH Serine/threonine-protein kinase ATG1b OS=Arabidopsis thaliana GN=ATG1B PE=2 SV=1 156 488 6.0E-15
sp|P25341|KIN82_YEAST Serine/threonine-protein kinase KIN82 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN82 PE=1 SV=3 150 454 7.0E-15
sp|P42684|ABL2_HUMAN Abelson tyrosine-protein kinase 2 OS=Homo sapiens GN=ABL2 PE=1 SV=1 165 470 7.0E-15
sp|Q9V3Q6|M3K7_DROME Mitogen-activated protein kinase kinase kinase 7 OS=Drosophila melanogaster GN=Tak1 PE=2 SV=1 139 464 7.0E-15
sp|P39688|FYN_MOUSE Tyrosine-protein kinase Fyn OS=Mus musculus GN=Fyn PE=1 SV=4 194 456 7.0E-15
sp|P25389|KCC4_YEAST Probable serine/threonine-protein kinase KCC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KCC4 PE=1 SV=3 155 461 7.0E-15
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 155 461 7.0E-15
sp|Q5AG71|HSL1_CANAL Serine/threonine-protein kinase HSL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSL1 PE=1 SV=1 155 461 8.0E-15
sp|P0C8M8|CCR1_MAIZE Probable serine/threonine-protein kinase CCRP1 OS=Zea mays GN=CCRP1 PE=1 SV=1 194 461 9.0E-15
sp|P10447|ABL_FSVHY Tyrosine-protein kinase transforming protein Abl OS=Feline sarcoma virus (strain Hardy-Zuckerman 2) GN=ABL PE=2 SV=1 165 460 9.0E-15
sp|P00522|ABL_DROME Tyrosine-protein kinase Abl OS=Drosophila melanogaster GN=Abl PE=1 SV=3 165 464 9.0E-15
sp|Q8NG66|NEK11_HUMAN Serine/threonine-protein kinase Nek11 OS=Homo sapiens GN=NEK11 PE=1 SV=2 150 461 9.0E-15
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 155 472 9.0E-15
sp|O00141|SGK1_HUMAN Serine/threonine-protein kinase Sgk1 OS=Homo sapiens GN=SGK1 PE=1 SV=2 155 477 9.0E-15
sp|P13406|FYN_XENLA Tyrosine-protein kinase Fyn OS=Xenopus laevis GN=fyn PE=2 SV=3 194 456 9.0E-15
sp|O45539|SRC2_CAEEL Tyrosine protein-kinase src-2 OS=Caenorhabditis elegans GN=src-2 PE=1 SV=2 197 471 9.0E-15
sp|Q80XI6|M3K11_MOUSE Mitogen-activated protein kinase kinase kinase 11 OS=Mus musculus GN=Map3k11 PE=1 SV=1 146 405 9.0E-15
sp|Q8VHF0|MARK3_RAT MAP/microtubule affinity-regulating kinase 3 OS=Rattus norvegicus GN=Mark3 PE=1 SV=1 155 461 9.0E-15
sp|Q00771|KCC1_EMENI Calcium/calmodulin-dependent protein kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cmkA PE=2 SV=2 155 461 1.0E-14
sp|Q66HA1|M3K11_RAT Mitogen-activated protein kinase kinase kinase 11 OS=Rattus norvegicus GN=Map3k11 PE=1 SV=1 146 405 1.0E-14
sp|P51954|NEK1_MOUSE Serine/threonine-protein kinase Nek1 OS=Mus musculus GN=Nek1 PE=1 SV=2 150 511 1.0E-14
sp|Q05876|FYN_CHICK Tyrosine-protein kinase Fyn OS=Gallus gallus GN=FYN PE=1 SV=2 288 456 1.0E-14
sp|P13115|SRC1_XENLA Tyrosine-protein kinase Src-1 OS=Xenopus laevis GN=src-a PE=2 SV=4 194 456 1.0E-14
sp|Q9Z139|ROR1_MOUSE Inactive tyrosine-protein kinase transmembrane receptor ROR1 OS=Mus musculus GN=Ror1 PE=2 SV=2 199 510 1.0E-14
sp|P15054|SRC_AVIS2 Tyrosine-protein kinase transforming protein Src OS=Avian sarcoma virus (strain PR2257) GN=V-SRC PE=3 SV=3 194 456 1.0E-14
sp|Q869W6|MYLKG_DICDI Probable myosin light chain kinase DDB_G0275057 OS=Dictyostelium discoideum GN=DDB_G0275057 PE=3 SV=1 149 399 1.0E-14
sp|Q6P6U0|FGR_RAT Tyrosine-protein kinase Fgr OS=Rattus norvegicus GN=Fgr PE=1 SV=1 287 456 1.0E-14
sp|Q03141|MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus GN=Mark3 PE=1 SV=2 155 461 1.0E-14
sp|P13116|SRC2_XENLA Tyrosine-protein kinase Src-2 OS=Xenopus laevis GN=src-b PE=2 SV=3 194 456 1.0E-14
sp|P14085|SRC_AVIST Tyrosine-protein kinase transforming protein Src OS=Avian sarcoma virus (strain S2) GN=V-SRC PE=3 SV=3 194 456 1.0E-14
sp|Q80ZW0|STK35_MOUSE Serine/threonine-protein kinase 35 OS=Mus musculus GN=Stk35 PE=1 SV=3 194 474 1.0E-14
sp|Q95KR7|LCK_SAISC Proto-oncogene tyrosine-protein kinase LCK OS=Saimiri sciureus GN=LCK PE=1 SV=3 287 456 1.0E-14
sp|F4JTP5|STY46_ARATH Serine/threonine-protein kinase STY46 OS=Arabidopsis thaliana GN=STY46 PE=1 SV=1 295 489 1.0E-14
sp|B2DD29|BRSK1_RAT Serine/threonine-protein kinase BRSK1 OS=Rattus norvegicus GN=Brsk1 PE=1 SV=1 144 460 1.0E-14
sp|Q5RJI5|BRSK1_MOUSE Serine/threonine-protein kinase BRSK1 OS=Mus musculus GN=Brsk1 PE=1 SV=1 144 460 1.0E-14
sp|P42690|SRK4_SPOLA Tyrosine-protein kinase isoform SRK4 OS=Spongilla lacustris GN=SRK1 PE=2 SV=1 288 456 1.0E-14
sp|Q4R633|SGK1_MACFA Serine/threonine-protein kinase Sgk1 OS=Macaca fascicularis GN=SGK1 PE=2 SV=1 155 477 1.0E-14
sp|Q54VI1|FHKE_DICDI Probable serine/threonine-protein kinase fhkE OS=Dictyostelium discoideum GN=fhkE PE=3 SV=1 149 461 1.0E-14
sp|Q6NSM8|SIK3_DANRE Serine/threonine-protein kinase SIK3 homolog OS=Danio rerio GN=zgc:66101 PE=2 SV=1 149 460 1.0E-14
sp|Q8TDC3|BRSK1_HUMAN Serine/threonine-protein kinase BRSK1 OS=Homo sapiens GN=BRSK1 PE=1 SV=2 144 460 1.0E-14
sp|Q6ERS4|CIPKG_ORYSJ CBL-interacting protein kinase 16 OS=Oryza sativa subsp. japonica GN=CIPK16 PE=2 SV=1 193 461 1.0E-14
sp|Q19469|SAD1_CAEEL Serine/threonine kinase SAD-1 OS=Caenorhabditis elegans GN=sad-1 PE=1 SV=2 153 461 1.0E-14
sp|P14084|SRC_AVISS Tyrosine-protein kinase transforming protein Src OS=Avian sarcoma virus (strain S1) GN=V-SRC PE=3 SV=3 194 456 1.0E-14
sp|Q8TDR2|STK35_HUMAN Serine/threonine-protein kinase 35 OS=Homo sapiens GN=STK35 PE=1 SV=2 194 474 2.0E-14
sp|P00523|SRC_CHICK Proto-oncogene tyrosine-protein kinase Src OS=Gallus gallus GN=SRC PE=1 SV=4 194 456 2.0E-14
sp|Q63572|TESK1_RAT Dual specificity testis-specific protein kinase 1 OS=Rattus norvegicus GN=Tesk1 PE=1 SV=1 156 389 2.0E-14
sp|Q8WNU8|NEK11_MACFA Serine/threonine-protein kinase Nek11 OS=Macaca fascicularis GN=NEK11 PE=2 SV=1 150 461 2.0E-14
sp|P10936|YES_XENLA Tyrosine-protein kinase Yes OS=Xenopus laevis GN=yes1 PE=2 SV=3 194 456 2.0E-14
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 155 461 2.0E-14
sp|Q802A6|STK4_SQUAC Serine/threonine-protein kinase 3/4 OS=Squalus acanthias GN=STK4 PE=2 SV=1 135 399 2.0E-14
sp|P25020|SRC_RSVH1 Tyrosine-protein kinase transforming protein Src OS=Rous sarcoma virus (strain H-19) GN=V-SRC PE=1 SV=3 194 456 2.0E-14
sp|Q9EQY0|ERN1_MOUSE Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Mus musculus GN=Ern1 PE=1 SV=1 295 461 2.0E-14
sp|Q5BKK4|SGK1_XENTR Serine/threonine-protein kinase Sgk1 OS=Xenopus tropicalis GN=sgk1 PE=2 SV=1 155 477 2.0E-14
sp|Q6U1I9|SGK1_CHICK Serine/threonine-protein kinase Sgk1 OS=Gallus gallus GN=SGK1 PE=2 SV=1 155 477 2.0E-14
sp|Q01973|ROR1_HUMAN Inactive tyrosine-protein kinase transmembrane receptor ROR1 OS=Homo sapiens GN=ROR1 PE=1 SV=2 199 510 2.0E-14
sp|P06239|LCK_HUMAN Tyrosine-protein kinase Lck OS=Homo sapiens GN=LCK PE=1 SV=6 287 456 2.0E-14
sp|Q8IBS5|CDPK4_PLAF7 Calcium-dependent protein kinase 4 OS=Plasmodium falciparum (isolate 3D7) GN=CPK4 PE=1 SV=3 155 461 3.0E-14
sp|Q6GPN6|SGK1A_XENLA Serine/threonine-protein kinase Sgk1-A OS=Xenopus laevis GN=sgk1-a PE=2 SV=1 155 477 3.0E-14
sp|O01775|NEKL2_CAEEL Serine/threonine-protein kinase nekl-2 OS=Caenorhabditis elegans GN=nekl-2 PE=2 SV=1 155 403 3.0E-14
sp|Q91821|MELK_XENLA Maternal embryonic leucine zipper kinase OS=Xenopus laevis GN=melk PE=1 SV=2 146 461 3.0E-14
sp|Q9Y2K2|SIK3_HUMAN Serine/threonine-protein kinase SIK3 OS=Homo sapiens GN=SIK3 PE=1 SV=3 149 460 3.0E-14
sp|P00526|SRC_RSVP Tyrosine-protein kinase transforming protein Src OS=Rous sarcoma virus (strain Prague C) GN=V-SRC PE=1 SV=3 194 456 3.0E-14
sp|Q9WUD9|SRC_RAT Proto-oncogene tyrosine-protein kinase Src OS=Rattus norvegicus GN=Src PE=1 SV=4 194 456 3.0E-14
sp|P05480|SRC_MOUSE Neuronal proto-oncogene tyrosine-protein kinase Src OS=Mus musculus GN=Src PE=1 SV=4 194 456 3.0E-14
sp|Q9XT18|SGK1_RABIT Serine/threonine-protein kinase Sgk1 OS=Oryctolagus cuniculus GN=SGK1 PE=2 SV=1 155 477 3.0E-14
sp|Q4P0K0|ATG1_USTMA Serine/threonine-protein kinase ATG1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ATG1 PE=2 SV=1 199 429 3.0E-14
sp|O61267|LOK_DROME Ovarian-specific serine/threonine-protein kinase Lok OS=Drosophila melanogaster GN=lok PE=2 SV=1 147 461 3.0E-14
sp|Q9JI10|STK3_MOUSE Serine/threonine-protein kinase 3 OS=Mus musculus GN=Stk3 PE=1 SV=1 126 399 3.0E-14
sp|Q9Z265|CHK2_MOUSE Serine/threonine-protein kinase Chk2 OS=Mus musculus GN=Chek2 PE=1 SV=1 143 461 3.0E-14
sp|F1SPM8|AAK1_PIG AP2-associated protein kinase 1 OS=Sus scrofa GN=AAK1 PE=2 SV=2 153 399 4.0E-14
sp|Q6P4S6|SIK3_MOUSE Serine/threonine-protein kinase SIK3 OS=Mus musculus GN=Sik3 PE=1 SV=3 149 460 4.0E-14
sp|Q8ICR0|CDPK2_PLAF7 Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate 3D7) GN=CPK2 PE=2 SV=3 199 461 4.0E-14
sp|Q2M2I8|AAK1_HUMAN AP2-associated protein kinase 1 OS=Homo sapiens GN=AAK1 PE=1 SV=3 153 399 4.0E-14
sp|O70146|TESK1_MOUSE Dual specificity testis-specific protein kinase 1 OS=Mus musculus GN=Tesk1 PE=1 SV=3 156 389 4.0E-14
sp|A8XJW8|CST1_CAEBR Serine/threonine-protein kinase cst-1 OS=Caenorhabditis briggsae GN=cst-1 PE=3 SV=2 156 399 4.0E-14
sp|P22216|RAD53_YEAST Serine/threonine-protein kinase RAD53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD53 PE=1 SV=1 124 406 4.0E-14
sp|Q8VCT9|TESK2_MOUSE Dual specificity testis-specific protein kinase 2 OS=Mus musculus GN=Tesk2 PE=1 SV=1 128 524 4.0E-14
sp|Q01621|LCK_RAT Proto-oncogene tyrosine-protein kinase LCK OS=Rattus norvegicus GN=Lck PE=1 SV=3 287 456 4.0E-14
sp|Q2QMH1|NEK2_ORYSJ Serine/threonine-protein kinase Nek2 OS=Oryza sativa subsp. japonica GN=NEK2 PE=2 SV=1 156 461 4.0E-14
sp|O15865|CDPK2_PLAFK Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK2 PE=1 SV=3 199 461 5.0E-14
sp|Q9WVC6|SGK1_MOUSE Serine/threonine-protein kinase Sgk1 OS=Mus musculus GN=Sgk1 PE=1 SV=1 155 477 5.0E-14
sp|Q9NB31|CST1_CAEEL Serine/threonine-protein kinase cst-1 OS=Caenorhabditis elegans GN=cst-1 PE=1 SV=1 156 399 5.0E-14
sp|A2ZMH2|NEK2_ORYSI Serine/threonine-protein kinase Nek2 OS=Oryza sativa subsp. indica GN=NEK2 PE=3 SV=1 156 461 5.0E-14
sp|Q75CH3|ATG1_ASHGO Serine/threonine-protein kinase ATG1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATG1 PE=3 SV=1 150 461 5.0E-14
sp|P63185|SRC_RSVSE Tyrosine-protein kinase transforming protein Src OS=Rous sarcoma virus (strain Schmidt-Ruppin E) GN=V-SRC PE=1 SV=3 194 456 5.0E-14
sp|Q16584|M3K11_HUMAN Mitogen-activated protein kinase kinase kinase 11 OS=Homo sapiens GN=MAP3K11 PE=1 SV=1 146 405 5.0E-14
sp|Q5Q0U5|SGK1_FUNHE Serine/threonine-protein kinase Sgk1 OS=Fundulus heteroclitus GN=sgk1 PE=2 SV=1 155 477 6.0E-14
sp|Q8TFN2|ATG1_PICAN Serine/threonine-protein kinase ATG1 OS=Pichia angusta GN=ATG1 PE=3 SV=1 189 454 6.0E-14
sp|O75460|ERN1_HUMAN Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Homo sapiens GN=ERN1 PE=1 SV=2 295 461 6.0E-14
sp|F1MH24|AAK1_BOVIN AP2-associated protein kinase 1 OS=Bos taurus GN=AAK1 PE=1 SV=2 153 399 6.0E-14
sp|Q94CU5|NEK5_ORYSJ Serine/threonine-protein kinase Nek5 OS=Oryza sativa subsp. japonica GN=NEK5 PE=3 SV=1 156 461 6.0E-14
sp|P00531|MIL_AVIMH Serine/threonine-protein kinase-transforming protein mil OS=Avian retrovirus MH2 GN=V-MIL PE=3 SV=1 125 505 6.0E-14
sp|P38692|KIC1_YEAST Serine/threonine-protein kinase KIC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIC1 PE=1 SV=1 148 461 6.0E-14
sp|P31152|MK04_HUMAN Mitogen-activated protein kinase 4 OS=Homo sapiens GN=MAPK4 PE=1 SV=2 150 457 6.0E-14
sp|Q12263|GIN4_YEAST Serine/threonine-protein kinase GIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIN4 PE=1 SV=1 199 461 7.0E-14
sp|P00524|SRC_RSVSA Tyrosine-protein kinase transforming protein Src OS=Avian leukosis virus RSA GN=V-SRC PE=1 SV=5 194 456 7.0E-14
sp|P00525|SRC_AVISR Tyrosine-protein kinase transforming protein Src OS=Avian sarcoma virus (strain rASV1441) GN=V-SRC PE=1 SV=3 194 456 7.0E-14
sp|Q01974|ROR2_HUMAN Tyrosine-protein kinase transmembrane receptor ROR2 OS=Homo sapiens GN=ROR2 PE=1 SV=2 101 486 7.0E-14
sp|P09324|YES_CHICK Tyrosine-protein kinase Yes OS=Gallus gallus GN=YES1 PE=1 SV=3 288 456 7.0E-14
sp|P0C1X8|AAK1_RAT AP2-associated protein kinase 1 OS=Rattus norvegicus GN=Aak1 PE=1 SV=1 155 399 8.0E-14
sp|P00527|YES_AVISY Tyrosine-protein kinase transforming protein Yes (Fragment) OS=Avian sarcoma virus (strain Y73) GN=V-YES PE=3 SV=2 288 456 8.0E-14
sp|P08103|HCK_MOUSE Tyrosine-protein kinase HCK OS=Mus musculus GN=Hck PE=1 SV=4 300 456 9.0E-14
sp|P21709|EPHA1_HUMAN Ephrin type-A receptor 1 OS=Homo sapiens GN=EPHA1 PE=1 SV=4 287 471 1.0E-13
sp|P50545|HCK_RAT Tyrosine-protein kinase HCK OS=Rattus norvegicus GN=Hck PE=1 SV=4 300 456 1.0E-13
sp|P06240|LCK_MOUSE Proto-oncogene tyrosine-protein kinase LCK OS=Mus musculus GN=Lck PE=1 SV=4 287 456 1.0E-13
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 199 461 1.0E-13
sp|Q60DG4|NEK4_ORYSJ Serine/threonine-protein kinase Nek4 OS=Oryza sativa subsp. japonica GN=NEK4 PE=2 SV=1 156 461 1.0E-13
sp|Q5PXS1|LCK_AOTNA Tyrosine-protein kinase Lck OS=Aotus nancymaae GN=LCK PE=2 SV=4 287 456 1.0E-13
sp|Q924U5|TESK2_RAT Dual specificity testis-specific protein kinase 2 OS=Rattus norvegicus GN=Tesk2 PE=2 SV=1 128 524 1.0E-13
sp|Q3UHJ0|AAK1_MOUSE AP2-associated protein kinase 1 OS=Mus musculus GN=Aak1 PE=1 SV=2 153 399 1.0E-13
sp|Q9GM70|ST17A_RABIT Serine/threonine-protein kinase 17A OS=Oryctolagus cuniculus GN=STK17A PE=2 SV=1 291 461 1.0E-13
sp|O70405|ULK1_MOUSE Serine/threonine-protein kinase ULK1 OS=Mus musculus GN=Ulk1 PE=1 SV=1 150 403 1.0E-13
sp|O15111|IKKA_HUMAN Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Homo sapiens GN=CHUK PE=1 SV=2 156 399 1.0E-13
sp|Q7ZUQ3|STK3_DANRE Serine/threonine-protein kinase 3 OS=Danio rerio GN=stk3 PE=2 SV=1 135 461 1.0E-13
sp|P42686|SRK1_SPOLA Tyrosine-protein kinase isoform SRK1 OS=Spongilla lacustris GN=SRK1 PE=2 SV=1 288 472 1.0E-13
sp|Q9P0L2|MARK1_HUMAN Serine/threonine-protein kinase MARK1 OS=Homo sapiens GN=MARK1 PE=1 SV=2 153 403 1.0E-13
sp|P0CP70|ATG1_CRYNJ Serine/threonine-protein kinase ATG1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATG1 PE=3 SV=1 193 454 1.0E-13
sp|Q6GLY8|SGK1B_XENLA Serine/threonine-protein kinase Sgk1-B OS=Xenopus laevis GN=sgk1-b PE=2 SV=1 155 477 1.0E-13
sp|Q28GW8|MELK_XENTR Maternal embryonic leucine zipper kinase OS=Xenopus tropicalis GN=melk PE=2 SV=1 146 461 1.0E-13
sp|O75385|ULK1_HUMAN Serine/threonine-protein kinase ULK1 OS=Homo sapiens GN=ULK1 PE=1 SV=2 150 403 1.0E-13
sp|P0CP71|ATG1_CRYNB Serine/threonine-protein kinase ATG1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ATG1 PE=3 SV=1 193 454 1.0E-13
sp|A4K2M3|STK4_PAPAN Serine/threonine-protein kinase 4 OS=Papio anubis GN=STK4 PE=3 SV=1 135 399 1.0E-13
sp|F4I1N8|ATG1T_ARATH Serine/threonine-protein kinase ATG1t OS=Arabidopsis thaliana GN=At1g49180 PE=2 SV=1 199 406 2.0E-13
sp|Q13188|STK3_HUMAN Serine/threonine-protein kinase 3 OS=Homo sapiens GN=STK3 PE=1 SV=2 126 399 2.0E-13
sp|Q95KV1|IKKA_BOVIN Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Bos taurus GN=CHUK PE=1 SV=1 156 399 2.0E-13
sp|Q5E9L6|STK4_BOVIN Serine/threonine-protein kinase 4 OS=Bos taurus GN=STK4 PE=2 SV=1 135 399 2.0E-13
sp|Q6PA14|STK4_XENLA Serine/threonine-protein kinase 4 OS=Xenopus laevis GN=stk4 PE=2 SV=1 156 399 2.0E-13
sp|A4K2S1|STK4_LEMCA Serine/threonine-protein kinase 4 OS=Lemur catta GN=STK4 PE=3 SV=1 135 399 2.0E-13
sp|O54748|STK3_RAT Serine/threonine-protein kinase 3 OS=Rattus norvegicus GN=Stk3 PE=1 SV=1 126 399 2.0E-13
sp|Q92918|M4K1_HUMAN Mitogen-activated protein kinase kinase kinase kinase 1 OS=Homo sapiens GN=MAP4K1 PE=1 SV=1 156 461 2.0E-13
sp|P42682|TXK_MOUSE Tyrosine-protein kinase TXK OS=Mus musculus GN=Txk PE=1 SV=1 150 461 2.0E-13
sp|Q8VDU5|SNRK_MOUSE SNF-related serine/threonine-protein kinase OS=Mus musculus GN=Snrk PE=1 SV=1 153 460 2.0E-13
sp|P12931|SRC_HUMAN Proto-oncogene tyrosine-protein kinase Src OS=Homo sapiens GN=SRC PE=1 SV=3 194 456 2.0E-13
sp|A4K2Q5|STK4_OTOGA Serine/threonine-protein kinase 4 OS=Otolemur garnettii GN=STK4 PE=3 SV=1 135 399 2.0E-13
sp|Q02977|YRK_CHICK Proto-oncogene tyrosine-protein kinase Yrk OS=Gallus gallus GN=YRK PE=2 SV=2 288 456 2.0E-13
sp|Q13043|STK4_HUMAN Serine/threonine-protein kinase 4 OS=Homo sapiens GN=STK4 PE=1 SV=2 135 399 2.0E-13
sp|P62345|CDPK4_PLABA Calcium-dependent protein kinase 4 OS=Plasmodium berghei (strain Anka) GN=CPK4 PE=1 SV=2 155 461 2.0E-13
sp|Q06226|SGK1_RAT Serine/threonine-protein kinase Sgk1 OS=Rattus norvegicus GN=Sgk1 PE=1 SV=1 155 477 2.0E-13
sp|A4K2Y1|STK4_CHLAE Serine/threonine-protein kinase 4 OS=Chlorocebus aethiops GN=STK4 PE=3 SV=1 135 399 2.0E-13
sp|A4K2T0|STK4_MACMU Serine/threonine-protein kinase 4 OS=Macaca mulatta GN=STK4 PE=3 SV=1 135 399 2.0E-13
sp|A7MB74|SGK1_BOVIN Serine/threonine-protein kinase Sgk1 OS=Bos taurus GN=SGK1 PE=2 SV=1 155 477 2.0E-13
sp|Q1LX51|WEE2_DANRE Wee1-like protein kinase 2 OS=Danio rerio GN=wee2 PE=2 SV=2 106 460 2.0E-13
sp|Q55EC7|GEFX_DICDI RasGEF domain-containing serine/threonine-protein kinase X OS=Dictyostelium discoideum GN=gefX PE=2 SV=1 156 469 2.0E-13
sp|Q7RJG2|CDPK4_PLAYO Calcium-dependent protein kinase 4 OS=Plasmodium yoelii yoelii GN=CPK4 PE=3 SV=3 155 461 2.0E-13
sp|Q9JI11|STK4_MOUSE Serine/threonine-protein kinase 4 OS=Mus musculus GN=Stk4 PE=1 SV=1 135 399 2.0E-13
sp|Q9ZSA4|CDPKR_ARATH Calcium-dependent protein kinase 27 OS=Arabidopsis thaliana GN=CPK27 PE=1 SV=3 156 461 2.0E-13
sp|Q63553|SNRK_RAT SNF-related serine/threonine-protein kinase OS=Rattus norvegicus GN=Snrk PE=1 SV=1 153 460 2.0E-13
sp|Q91735|EPHB3_XENLA Ephrin type-B receptor 3 OS=Xenopus laevis GN=ephb3 PE=2 SV=1 153 508 2.0E-13
sp|P08631|HCK_HUMAN Tyrosine-protein kinase HCK OS=Homo sapiens GN=HCK PE=1 SV=5 300 456 2.0E-13
sp|A4K2P5|STK4_COLGU Serine/threonine-protein kinase 4 OS=Colobus guereza GN=STK4 PE=3 SV=1 135 399 2.0E-13
sp|Q3U1V8|M3K9_MOUSE Mitogen-activated protein kinase kinase kinase 9 OS=Mus musculus GN=Map3k9 PE=2 SV=2 146 405 3.0E-13
sp|Q12152|YP150_YEAST Putative serine/threonine-protein kinase YPL150W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL150W PE=1 SV=1 296 461 3.0E-13
sp|Q9NSY1|BMP2K_HUMAN BMP-2-inducible protein kinase OS=Homo sapiens GN=BMP2K PE=1 SV=2 153 399 3.0E-13
sp|Q9NRH2|SNRK_HUMAN SNF-related serine/threonine-protein kinase OS=Homo sapiens GN=SNRK PE=1 SV=2 153 460 3.0E-13
sp|P31693|SRC_RSVPA Tyrosine-protein kinase transforming protein Src OS=Rous sarcoma virus (strain PA101T) GN=V-SRC PE=3 SV=3 194 456 3.0E-13
sp|P80192|M3K9_HUMAN Mitogen-activated protein kinase kinase kinase 9 OS=Homo sapiens GN=MAP3K9 PE=1 SV=3 146 405 3.0E-13
sp|A4IFM7|MYLK2_BOVIN Myosin light chain kinase 2, skeletal/cardiac muscle OS=Bos taurus GN=MYLK2 PE=2 SV=1 155 401 3.0E-13
sp|Q15569|TESK1_HUMAN Dual specificity testis-specific protein kinase 1 OS=Homo sapiens GN=TESK1 PE=1 SV=2 156 516 3.0E-13
sp|P05625|RAF1_CHICK RAF proto-oncogene serine/threonine-protein kinase OS=Gallus gallus GN=RAF1 PE=2 SV=1 125 505 4.0E-13
sp|P11345|RAF1_RAT RAF proto-oncogene serine/threonine-protein kinase OS=Rattus norvegicus GN=Raf1 PE=1 SV=1 125 503 4.0E-13
sp|Q81WH6|PRKC_BACAN Serine/threonine-protein kinase PrkC OS=Bacillus anthracis GN=prkC PE=1 SV=1 155 458 4.0E-13
sp|Q9KIG4|PK1_STRTO Serine/threonine-protein kinase PK-1 OS=Streptomyces toyocaensis GN=spk1 PE=1 SV=1 189 401 4.0E-13
sp|P51813|BMX_HUMAN Cytoplasmic tyrosine-protein kinase BMX OS=Homo sapiens GN=BMX PE=1 SV=1 156 464 4.0E-13
sp|Q8SQW2|CTK1_ENCCU Probable CTD kinase subunit alpha homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=CTK1 PE=3 SV=1 287 485 4.0E-13
sp|Q75L42|CIPKH_ORYSJ CBL-interacting protein kinase 17 OS=Oryza sativa subsp. japonica GN=CIPK17 PE=2 SV=1 156 405 4.0E-13
sp|Q8RWL6|STY17_ARATH Serine/threonine-protein kinase STY17 OS=Arabidopsis thaliana GN=STY17 PE=1 SV=1 293 461 5.0E-13
sp|Q94C95|ATG1A_ARATH Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana GN=ATG1A PE=1 SV=1 156 464 5.0E-13
sp|Q23551|UNC22_CAEEL Twitchin OS=Caenorhabditis elegans GN=unc-22 PE=1 SV=3 156 461 5.0E-13
sp|Q5ZJK4|STK4_CHICK Serine/threonine-protein kinase 4 OS=Gallus gallus GN=STK4 PE=2 SV=1 135 399 5.0E-13
sp|Q9CAL8|PEK13_ARATH Proline-rich receptor-like protein kinase PERK13 OS=Arabidopsis thaliana GN=PERK13 PE=2 SV=1 150 484 5.0E-13
sp|Q8VHJ5|MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus GN=Mark1 PE=1 SV=2 153 403 5.0E-13
sp|Q39008|M3K1_ARATH Mitogen-activated protein kinase kinase kinase 1 OS=Arabidopsis thaliana GN=MEKK1 PE=1 SV=2 155 461 6.0E-13
sp|Q03146|DDR1_MOUSE Epithelial discoidin domain-containing receptor 1 OS=Mus musculus GN=Ddr1 PE=2 SV=2 197 455 6.0E-13
sp|P32562|CDC5_YEAST Cell cycle serine/threonine-protein kinase CDC5/MSD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC5 PE=1 SV=1 194 461 6.0E-13
sp|Q0WPH8|NEK5_ARATH Serine/threonine-protein kinase Nek5 OS=Arabidopsis thaliana GN=NEK5 PE=1 SV=1 156 461 6.0E-13
sp|Q75KK8|MPK14_ORYSJ Mitogen-activated protein kinase 14 OS=Oryza sativa subsp. japonica GN=MPK14 PE=2 SV=1 153 478 6.0E-13
sp|O08678|MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus GN=Mark1 PE=1 SV=1 153 403 6.0E-13
sp|Q99N57|RAF1_MOUSE RAF proto-oncogene serine/threonine-protein kinase OS=Mus musculus GN=Raf1 PE=1 SV=2 125 503 7.0E-13
sp|Q8WMV0|GRK7_BOVIN G protein-coupled receptor kinase 7 OS=Bos taurus GN=GRK7 PE=1 SV=1 142 400 7.0E-13
sp|Q7ZTW4|SGK1_DANRE Serine/threonine-protein kinase Sgk1 OS=Danio rerio GN=sgk1 PE=2 SV=1 155 477 7.0E-13
sp|Q0UY20|ATG1_PHANO Serine/threonine-protein kinase atg1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=ATG1 PE=3 SV=2 179 456 7.0E-13
sp|B4LDJ6|PLK4_DROVI Serine/threonine-protein kinase PLK4 OS=Drosophila virilis GN=SAK PE=3 SV=1 194 461 7.0E-13
sp|Q07014|LYN_RAT Tyrosine-protein kinase Lyn OS=Rattus norvegicus GN=Lyn PE=1 SV=3 300 456 8.0E-13
sp|Q54VU4|Y8013_DICDI Probable serine/threonine-protein kinase DDB_G0280133 OS=Dictyostelium discoideum GN=DDB_G0280133 PE=3 SV=1 155 461 8.0E-13
sp|Q91Z96|BMP2K_MOUSE BMP-2-inducible protein kinase OS=Mus musculus GN=Bmp2k PE=1 SV=1 153 399 8.0E-13
sp|A6QGC0|PRKC_STAAE Serine/threonine-protein kinase PrkC OS=Staphylococcus aureus (strain Newman) GN=prkC PE=1 SV=1 156 454 8.0E-13
sp|Q4G3H4|IKKA_DANRE Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Danio rerio GN=chuk PE=1 SV=1 150 399 8.0E-13
sp|P20689|MYLK2_RAT Myosin light chain kinase 2, skeletal/cardiac muscle OS=Rattus norvegicus GN=Mylk2 PE=1 SV=2 156 461 8.0E-13
sp|P53104|ATG1_YEAST Serine/threonine-protein kinase ATG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATG1 PE=1 SV=1 150 454 9.0E-13
sp|A6ZU07|ATG1_YEAS7 Serine/threonine-protein kinase ATG1 OS=Saccharomyces cerevisiae (strain YJM789) GN=ATG1 PE=3 SV=1 150 454 9.0E-13
sp|P25911|LYN_MOUSE Tyrosine-protein kinase Lyn OS=Mus musculus GN=Lyn PE=1 SV=4 300 456 9.0E-13
sp|Q8CBF3|EPHB1_MOUSE Ephrin type-B receptor 1 OS=Mus musculus GN=Ephb1 PE=1 SV=1 148 461 9.0E-13
sp|Q10056|SHK2_SCHPO Serine/threonine-protein kinase shk2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk2 PE=3 SV=1 149 399 9.0E-13
sp|Q19238|YS3J_CAEEL Putative tyrosine-protein kinase F09A5.2 OS=Caenorhabditis elegans GN=F09A5.2 PE=3 SV=2 130 517 9.0E-13
sp|Q07494|EPHB1_CHICK Ephrin type-B receptor 1 (Fragment) OS=Gallus gallus GN=EPHB1 PE=2 SV=2 148 461 9.0E-13
sp|Q6IP06|STK3_XENLA Serine/threonine-protein kinase 3 OS=Xenopus laevis GN=stk3 PE=2 SV=1 135 461 9.0E-13
sp|Q8VCR8|MYLK2_MOUSE Myosin light chain kinase 2, skeletal/cardiac muscle OS=Mus musculus GN=Mylk2 PE=1 SV=2 156 461 1.0E-12
sp|Q16566|KCC4_HUMAN Calcium/calmodulin-dependent protein kinase type IV OS=Homo sapiens GN=CAMK4 PE=1 SV=1 138 461 1.0E-12
sp|P09759|EPHB1_RAT Ephrin type-B receptor 1 OS=Rattus norvegicus GN=Ephb1 PE=1 SV=2 148 461 1.0E-12
sp|O22558|STY8_ARATH Serine/threonine-protein kinase STY8 OS=Arabidopsis thaliana GN=STY8 PE=1 SV=2 299 461 1.0E-12
sp|P13234|KCC4_RAT Calcium/calmodulin-dependent protein kinase type IV OS=Rattus norvegicus GN=Camk4 PE=1 SV=3 149 461 1.0E-12
sp|Q60680|IKKA_MOUSE Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Mus musculus GN=Chuk PE=1 SV=1 156 399 1.0E-12
sp|O42626|NRC2_NEUCR Serine/threonine-protein kinase nrc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nrc-2 PE=3 SV=1 135 403 1.0E-12
sp|P08414|KCC4_MOUSE Calcium/calmodulin-dependent protein kinase type IV OS=Mus musculus GN=Camk4 PE=1 SV=2 149 461 1.0E-12
sp|O96017|CHK2_HUMAN Serine/threonine-protein kinase Chk2 OS=Homo sapiens GN=CHEK2 PE=1 SV=1 143 461 1.0E-12
sp|Q54QI2|Y9877_DICDI Serine/threonine-protein kinase DDB_G0283821 OS=Dictyostelium discoideum GN=DDB_G0283821 PE=3 SV=1 193 399 1.0E-12
sp|Q55GU0|Y9955_DICDI Probable serine/threonine-protein kinase DDB_G0267514 OS=Dictyostelium discoideum GN=DDB_G0267514 PE=3 SV=1 156 461 1.0E-12
sp|P39009|DUN1_YEAST DNA damage response protein kinase DUN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUN1 PE=1 SV=1 150 461 1.0E-12
sp|A0AUV4|SMKY_MOUSE Sperm motility kinase Y OS=Mus musculus GN=Gm7168 PE=2 SV=1 156 461 1.0E-12
sp|P54762|EPHB1_HUMAN Ephrin type-B receptor 1 OS=Homo sapiens GN=EPHB1 PE=1 SV=1 148 461 1.0E-12
sp|P07948|LYN_HUMAN Tyrosine-protein kinase Lyn OS=Homo sapiens GN=LYN PE=1 SV=3 300 456 2.0E-12
sp|Q6L5F7|MPK17_ORYSJ Mitogen-activated protein kinase 17 OS=Oryza sativa subsp. japonica GN=MPK17 PE=2 SV=2 155 478 2.0E-12
sp|Q54TA3|MRKC_DICDI Probable serine/threonine-protein kinase MARK-C OS=Dictyostelium discoideum GN=mrkC PE=3 SV=1 199 418 2.0E-12
sp|Q64716|INSRR_RAT Insulin receptor-related protein OS=Rattus norvegicus GN=Insrr PE=1 SV=3 259 467 2.0E-12
sp|A1A5H8|YES_DANRE Tyrosine-protein kinase yes OS=Danio rerio GN=yes1 PE=1 SV=1 194 456 2.0E-12
sp|Q8KY50|STKP1_STRPN Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=stkP PE=1 SV=1 156 410 2.0E-12
sp|A7TIZ4|ATG1_VANPO Serine/threonine-protein kinase atg1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=ATG1 PE=3 SV=1 177 454 2.0E-12
sp|P15056|BRAF_HUMAN Serine/threonine-protein kinase B-raf OS=Homo sapiens GN=BRAF PE=1 SV=4 293 521 2.0E-12
sp|Q2QMI0|CIPK4_ORYSJ CBL-interacting protein kinase 4 OS=Oryza sativa subsp. japonica GN=CIPK4 PE=2 SV=2 155 403 2.0E-12
sp|Q86AD7|MYLKB_DICDI Probable myosin light chain kinase DDB_G0271550 OS=Dictyostelium discoideum GN=DDB_G0271550 PE=3 SV=1 156 461 2.0E-12
sp|Q8BZN4|NUAK2_MOUSE NUAK family SNF1-like kinase 2 OS=Mus musculus GN=Nuak2 PE=1 SV=2 150 460 2.0E-12
sp|Q54VV7|Y0111_DICDI Probable serine/threonine-protein kinase DDB_G0280111 OS=Dictyostelium discoideum GN=DDB_G0280111 PE=3 SV=1 128 460 2.0E-12
sp|Q6NU47|PDK1A_XENLA Serine/threonine-protein kinase pdik1l-A OS=Xenopus laevis GN=pdik1-a PE=2 SV=1 227 460 2.0E-12
sp|P07947|YES_HUMAN Tyrosine-protein kinase Yes OS=Homo sapiens GN=YES1 PE=1 SV=3 288 456 2.0E-12
sp|Q8C0N0|SMKZ_MOUSE Sperm motility kinase Z OS=Mus musculus GN=Gm4922 PE=2 SV=1 141 461 3.0E-12
sp|F1LM93|YES_RAT Tyrosine-protein kinase Yes OS=Rattus norvegicus GN=Yes1 PE=1 SV=1 288 456 3.0E-12
sp|Q1JPZ3|SRC_DANRE Proto-oncogene tyrosine-protein kinase Src OS=Danio rerio GN=src PE=1 SV=2 194 456 3.0E-12
sp|Q6NU98|PDK1B_XENLA Serine/threonine-protein kinase pdik1l-B OS=Xenopus laevis GN=pdik1-b PE=2 SV=1 227 460 3.0E-12
sp|P08923|LTK_MOUSE Leukocyte tyrosine kinase receptor OS=Mus musculus GN=Ltk PE=1 SV=3 180 461 3.0E-12
sp|Q04736|YES_MOUSE Tyrosine-protein kinase Yes OS=Mus musculus GN=Yes1 PE=1 SV=3 288 456 3.0E-12
sp|Q10407|MKH1_SCHPO MAP kinase kinase kinase mkh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mkh1 PE=3 SV=1 119 406 3.0E-12
sp|Q9UEE5|ST17A_HUMAN Serine/threonine-protein kinase 17A OS=Homo sapiens GN=STK17A PE=1 SV=2 291 461 3.0E-12
sp|Q95M30|HCK_MACFA Tyrosine-protein kinase HCK OS=Macaca fascicularis GN=HCK PE=2 SV=3 300 456 3.0E-12
sp|A4K2W5|STK4_AOTNA Serine/threonine-protein kinase 4 OS=Aotus nancymaae GN=STK4 PE=3 SV=1 135 399 3.0E-12
sp|P10533|RMIL_AVII1 Serine/threonine-protein kinase-transforming protein Rmil OS=Avian retrovirus IC10 GN=V-RMIL PE=3 SV=1 293 464 3.0E-12
sp|Q4V7Q6|ULK3_XENLA Serine/threonine-protein kinase ULK3 OS=Xenopus laevis GN=ulk3 PE=2 SV=1 189 461 4.0E-12
sp|P27966|RMIL_AVEVR Serine/threonine-protein kinase-transforming protein Rmil OS=Avian rous-associated virus type 1 GN=V-RMIL PE=3 SV=1 293 464 4.0E-12
sp|Q07497|EPHB5_CHICK Ephrin type-B receptor 5 OS=Gallus gallus GN=EPHB5 PE=2 SV=1 141 464 4.0E-12
sp|Q12100|RTK1_YEAST Probable serine/threonine-protein kinase RTK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTK1 PE=1 SV=1 288 461 4.0E-12
sp|P11346|KRAF1_DROME Raf homolog serine/threonine-protein kinase phl OS=Drosophila melanogaster GN=phl PE=1 SV=6 76 455 4.0E-12
sp|P09208|INSR_DROME Insulin-like receptor OS=Drosophila melanogaster GN=InR PE=1 SV=3 234 461 4.0E-12
sp|Q12706|PSK1_SCHPO Serine/threonine-protein kinase psk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psk1 PE=3 SV=1 154 458 4.0E-12
sp|Q09499|IRE1_CAEEL Serine/threonine-protein kinase/endoribonuclease ire-1 OS=Caenorhabditis elegans GN=ire-1 PE=1 SV=2 274 461 4.0E-12
sp|Q97PA9|STKP2_STRPN Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=stkP PE=1 SV=1 156 471 4.0E-12
sp|Q5VP69|MPK16_ORYSJ Mitogen-activated protein kinase 16 OS=Oryza sativa subsp. japonica GN=MPK16 PE=2 SV=1 155 478 4.0E-12
sp|Q5TCX8|M3KL4_HUMAN Mitogen-activated protein kinase kinase kinase MLK4 OS=Homo sapiens GN=MLK4 PE=1 SV=1 155 405 5.0E-12
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 85 401 5.0E-12
sp|Q12701|KSG1_SCHPO Serine/threonine-protein kinase ksg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ksg1 PE=1 SV=2 300 460 5.0E-12
sp|D0N4E2|PKZ1_PHYIT Serine/threonine-protein kinase PKZ1 OS=Phytophthora infestans (strain T30-4) GN=PKZ1 PE=3 SV=1 156 461 5.0E-12
sp|Q5R8Z4|PAK6_PONAB Serine/threonine-protein kinase PAK 6 OS=Pongo abelii GN=PAK6 PE=2 SV=1 135 461 5.0E-12
sp|Q28923|YES_CANLF Tyrosine-protein kinase Yes OS=Canis lupus familiaris GN=YES1 PE=1 SV=3 288 456 5.0E-12
sp|P28028|BRAF_MOUSE Serine/threonine-protein kinase B-raf OS=Mus musculus GN=Braf PE=1 SV=3 293 489 5.0E-12
sp|Q6P3Q4|STK4_XENTR Serine/threonine-protein kinase 4 OS=Xenopus tropicalis GN=stk4 PE=2 SV=1 156 399 5.0E-12
sp|Q9NQU5|PAK6_HUMAN Serine/threonine-protein kinase PAK 6 OS=Homo sapiens GN=PAK6 PE=1 SV=1 135 461 5.0E-12
sp|Q63474|DDR1_RAT Epithelial discoidin domain-containing receptor 1 OS=Rattus norvegicus GN=Ddr1 PE=2 SV=1 197 460 5.0E-12
sp|Q9LEU7|CIPK5_ARATH CBL-interacting serine/threonine-protein kinase 5 OS=Arabidopsis thaliana GN=CIPK5 PE=2 SV=1 155 461 5.0E-12
sp|Q9LGV5|CIPK1_ORYSJ CBL-interacting protein kinase 1 OS=Oryza sativa subsp. japonica GN=CIPK1 PE=2 SV=1 156 405 5.0E-12
sp|P24604|TEC_MOUSE Tyrosine-protein kinase Tec OS=Mus musculus GN=Tec PE=1 SV=2 281 461 6.0E-12
sp|P07313|MYLK2_RABIT Myosin light chain kinase 2, skeletal/cardiac muscle OS=Oryctolagus cuniculus GN=MYLK2 PE=1 SV=3 155 401 6.0E-12
sp|Q8DNS0|STKP_STRR6 Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=stkP PE=1 SV=1 156 410 6.0E-12
sp|Q04J43|STKP_STRP2 Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=stkP PE=1 SV=1 156 410 6.0E-12
sp|Q7YR43|DDR1_PANTR Epithelial discoidin domain-containing receptor 1 OS=Pan troglodytes GN=DDR1 PE=3 SV=1 197 460 6.0E-12
sp|Q501V0|KPSH1_DANRE Serine/threonine-protein kinase H1 homolog OS=Danio rerio GN=pskh1 PE=2 SV=2 86 461 6.0E-12
sp|B4J3F1|PLK4_DROGR Serine/threonine-protein kinase PLK4 OS=Drosophila grimshawi GN=SAK PE=3 SV=1 195 461 6.0E-12
sp|Q7RAV5|CDPK3_PLAYO Calcium-dependent protein kinase 3 OS=Plasmodium yoelii yoelii GN=CPK3 PE=3 SV=1 199 461 6.0E-12
sp|Q6P5G0|MK04_MOUSE Mitogen-activated protein kinase 4 OS=Mus musculus GN=Mapk4 PE=1 SV=1 150 457 6.0E-12
sp|P34908|BRAF_COTJA Serine/threonine-protein kinase B-raf OS=Coturnix coturnix japonica GN=BRAF PE=2 SV=1 293 464 6.0E-12
sp|Q08345|DDR1_HUMAN Epithelial discoidin domain-containing receptor 1 OS=Homo sapiens GN=DDR1 PE=1 SV=1 197 460 6.0E-12
sp|Q04982|BRAF_CHICK Serine/threonine-protein kinase B-raf OS=Gallus gallus GN=BRAF PE=1 SV=1 293 464 6.0E-12
sp|Q75H77|SAPKA_ORYSJ Serine/threonine-protein kinase SAPK10 OS=Oryza sativa subsp. japonica GN=SAPK10 PE=2 SV=1 156 460 6.0E-12
sp|P00532|RAF_MSV36 Serine/threonine-protein kinase-transforming protein raf OS=Murine sarcoma virus 3611 GN=V-RAF PE=3 SV=1 303 403 6.0E-12
sp|P54761|EPHB4_MOUSE Ephrin type-B receptor 4 OS=Mus musculus GN=Ephb4 PE=1 SV=2 153 464 7.0E-12
sp|Q8W1D5|CIPKP_ARATH CBL-interacting serine/threonine-protein kinase 25 OS=Arabidopsis thaliana GN=CIPK25 PE=2 SV=1 193 456 7.0E-12
sp|Q0D4B2|CIPKL_ORYSJ CBL-interacting protein kinase 21 OS=Oryza sativa subsp. japonica GN=CIPK21 PE=2 SV=2 156 405 7.0E-12
sp|Q62726|ICK_RAT Serine/threonine-protein kinase ICK OS=Rattus norvegicus GN=Ick PE=1 SV=1 156 461 7.0E-12
sp|P70218|M4K1_MOUSE Mitogen-activated protein kinase kinase kinase kinase 1 OS=Mus musculus GN=Map4k1 PE=1 SV=1 156 461 7.0E-12
sp|Q9V9J3|SRC42_DROME Tyrosine-protein kinase Src42A OS=Drosophila melanogaster GN=Src42A PE=2 SV=1 279 456 7.0E-12
sp|A7E3S4|RAF1_BOVIN RAF proto-oncogene serine/threonine-protein kinase OS=Bos taurus GN=RAF1 PE=2 SV=1 125 503 7.0E-12
sp|P14617|INSRR_CAVPO Insulin receptor-related protein OS=Cavia porcellus GN=INSRR PE=3 SV=1 259 467 7.0E-12
sp|Q9JKV2|ICK_MOUSE Serine/threonine-protein kinase ICK OS=Mus musculus GN=Ick PE=1 SV=2 156 461 8.0E-12
sp|Q8GVC7|PKZ1_PHYIN Serine/threonine-protein kinase PKZ1 OS=Phytophthora infestans GN=PKZ1 PE=1 SV=1 156 461 8.0E-12
sp|Q753D9|PKH3_ASHGO Serine/threonine-protein kinase PKH3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PKH3 PE=3 SV=1 300 487 8.0E-12
sp|P00528|SRC64_DROME Tyrosine-protein kinase Src64B OS=Drosophila melanogaster GN=Src64B PE=1 SV=3 288 456 8.0E-12
sp|O19004|ARAF_PIG Serine/threonine-protein kinase A-Raf OS=Sus scrofa GN=ARAF PE=2 SV=1 34 447 9.0E-12
sp|P54760|EPHB4_HUMAN Ephrin type-B receptor 4 OS=Homo sapiens GN=EPHB4 PE=1 SV=2 153 464 9.0E-12
sp|P54754|EPHB3_MOUSE Ephrin type-B receptor 3 OS=Mus musculus GN=Ephb3 PE=1 SV=2 153 461 9.0E-12
sp|P9WI67|PKNJ_MYCTU Serine/threonine-protein kinase PknJ OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknJ PE=1 SV=1 153 399 9.0E-12
sp|P9WI66|PKNJ_MYCTO Serine/threonine-protein kinase PknJ OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknJ PE=1 SV=1 153 399 9.0E-12
sp|P65733|PKNJ_MYCBO Serine/threonine-protein kinase PknJ OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknJ PE=3 SV=1 153 399 9.0E-12
sp|Q91736|EPB1B_XENLA Ephrin type-B receptor 1-B (Fragment) OS=Xenopus laevis GN=ephb1-b PE=1 SV=1 148 461 9.0E-12
sp|Q66HE5|NUAK2_RAT NUAK family SNF1-like kinase 2 OS=Rattus norvegicus GN=Nuak2 PE=1 SV=1 150 529 9.0E-12
sp|Q8T0S6|HIPPO_DROME Serine/threonine-protein kinase hippo OS=Drosophila melanogaster GN=hpo PE=1 SV=1 156 461 9.0E-12
sp|Q24488|ROR1_DROME Tyrosine-protein kinase transmembrane receptor Ror OS=Drosophila melanogaster GN=Ror PE=1 SV=1 199 460 9.0E-12
sp|P09560|RAF1_XENLA RAF proto-oncogene serine/threonine-protein kinase OS=Xenopus laevis GN=raf1 PE=2 SV=1 303 505 9.0E-12
sp|Q2V452|CIPK3_ARATH CBL-interacting serine/threonine-protein kinase 3 OS=Arabidopsis thaliana GN=CIPK3 PE=1 SV=2 190 406 1.0E-11
sp|Q9H1R3|MYLK2_HUMAN Myosin light chain kinase 2, skeletal/cardiac muscle OS=Homo sapiens GN=MYLK2 PE=1 SV=3 155 401 1.0E-11
sp|Q6IP76|AKT2B_XENLA RAC-beta serine/threonine-protein kinase B OS=Xenopus laevis GN=akt2-b PE=2 SV=1 155 454 1.0E-11
sp|P03949|ABL1_CAEEL Tyrosine-protein kinase abl-1 OS=Caenorhabditis elegans GN=abl-1 PE=1 SV=4 156 455 1.0E-11
sp|Q86CS2|ATG1_DICDI Serine/threonine-protein kinase atg1 OS=Dictyostelium discoideum GN=atg1 PE=3 SV=1 179 404 1.0E-11
sp|B4KYX8|PLK4_DROMO Serine/threonine-protein kinase PLK4 OS=Drosophila mojavensis GN=SAK PE=3 SV=1 199 461 1.0E-11
sp|Q9UPZ9|ICK_HUMAN Serine/threonine-protein kinase ICK OS=Homo sapiens GN=ICK PE=1 SV=1 156 461 1.0E-11
sp|Q8BG48|ST17B_MOUSE Serine/threonine-protein kinase 17B OS=Mus musculus GN=Stk17b PE=1 SV=1 281 461 1.0E-11
sp|Q3Y416|KKCC_CAEEL Calcium/calmodulin-dependent protein kinase kinase OS=Caenorhabditis elegans GN=ckk-1 PE=1 SV=2 108 399 1.0E-11
sp|Q61772|EPHA7_MOUSE Ephrin type-A receptor 7 OS=Mus musculus GN=Epha7 PE=1 SV=2 153 461 1.0E-11
sp|Q91XS8|ST17B_RAT Serine/threonine-protein kinase 17B OS=Rattus norvegicus GN=Stk17b PE=1 SV=1 281 461 1.0E-11
sp|Q9Z2G7|GRK7_ICTTR G protein-coupled receptor kinase 7 OS=Ictidomys tridecemlineatus GN=GRK7 PE=1 SV=1 149 400 1.0E-11
sp|Q8GUH1|PUB33_ARATH U-box domain-containing protein 33 OS=Arabidopsis thaliana GN=PUB33 PE=2 SV=2 108 448 1.0E-11
sp|Q6C7U0|ATG1_YARLI Serine/threonine-protein kinase ATG1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATG1 PE=3 SV=1 156 454 1.0E-11
sp|Q8VDG6|M3KL4_MOUSE Mitogen-activated protein kinase kinase kinase MLK4 OS=Mus musculus GN=Mlk4 PE=1 SV=2 146 405 1.0E-11
sp|Q54CY9|MYLKD_DICDI Probable myosin light chain kinase DDB_G0292624 OS=Dictyostelium discoideum GN=DDB_G0292624 PE=3 SV=1 156 461 1.0E-11
sp|Q54RZ7|Y1199_DICDI Probable serine/threonine-protein kinase DDB_G0282895 OS=Dictyostelium discoideum GN=DDB_G0282895 PE=3 SV=1 288 461 1.0E-11
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 142 464 1.0E-11
sp|P27447|YES_XIPHE Tyrosine-protein kinase Yes OS=Xiphophorus helleri GN=yes PE=2 SV=3 287 456 1.0E-11
sp|Q9H093|NUAK2_HUMAN NUAK family SNF1-like kinase 2 OS=Homo sapiens GN=NUAK2 PE=1 SV=1 150 489 1.0E-11
sp|Q8RXG3|M2K5_ARATH Mitogen-activated protein kinase kinase 5 OS=Arabidopsis thaliana GN=MKK5 PE=1 SV=2 291 399 1.0E-11
sp|Q5R7G9|NUAK2_PONAB NUAK family SNF1-like kinase 2 OS=Pongo abelii GN=NUAK2 PE=2 SV=1 150 489 1.0E-11
sp|Q9SEZ7|CIPKG_ARATH CBL-interacting serine/threonine-protein kinase 16 OS=Arabidopsis thaliana GN=CIPK16 PE=1 SV=1 186 470 2.0E-11
sp|O62305|KCC2D_CAEEL Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis elegans GN=unc-43 PE=1 SV=2 142 461 2.0E-11
sp|P92937|CIPKF_ARATH CBL-interacting serine/threonine-protein kinase 15 OS=Arabidopsis thaliana GN=CIPK15 PE=1 SV=2 161 461 2.0E-11
sp|B4IAQ8|PLK4_DROSE Serine/threonine-protein kinase PLK4 OS=Drosophila sechellia GN=SAK PE=3 SV=1 155 461 2.0E-11
sp|Q16W24|PLK4_AEDAE Serine/threonine-protein kinase PLK4 OS=Aedes aegypti GN=SAK PE=3 SV=1 155 485 2.0E-11
sp|Q9C9U4|MPK15_ARATH Mitogen-activated protein kinase 15 OS=Arabidopsis thaliana GN=MPK15 PE=1 SV=3 153 487 2.0E-11
sp|Q9FJ55|CIPKJ_ARATH CBL-interacting serine/threonine-protein kinase 19 OS=Arabidopsis thaliana GN=CIPK19 PE=2 SV=1 155 405 2.0E-11
sp|Q91618|PMYT1_XENLA Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Xenopus laevis GN=pkmyt1 PE=1 SV=1 145 461 2.0E-11
sp|Q6FL58|ATG1_CANGA Serine/threonine-protein kinase ATG1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATG1 PE=3 SV=1 150 454 2.0E-11
sp|Q7ZX15|AKT2A_XENLA RAC-beta serine/threonine-protein kinase A OS=Xenopus laevis GN=akt2-a PE=2 SV=1 155 454 2.0E-11
sp|Q6ZLP5|CIPKN_ORYSJ CBL-interacting protein kinase 23 OS=Oryza sativa subsp. japonica GN=CIPK23 PE=2 SV=1 190 461 2.0E-11
sp|O80397|M2K4_ARATH Mitogen-activated protein kinase kinase 4 OS=Arabidopsis thaliana GN=MKK4 PE=1 SV=1 291 399 2.0E-11
sp|Q5R5M7|RAF1_PONAB RAF proto-oncogene serine/threonine-protein kinase OS=Pongo abelii GN=RAF1 PE=2 SV=1 293 403 2.0E-11
sp|P04049|RAF1_HUMAN RAF proto-oncogene serine/threonine-protein kinase OS=Homo sapiens GN=RAF1 PE=1 SV=1 293 403 2.0E-11
sp|P11837|NIMA_EMENI G2-specific protein kinase nimA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nimA PE=1 SV=1 156 492 2.0E-11
sp|P54645|AAPK1_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Rattus norvegicus GN=Prkaa1 PE=1 SV=2 150 460 2.0E-11
sp|Q8BW96|KCC1D_MOUSE Calcium/calmodulin-dependent protein kinase type 1D OS=Mus musculus GN=Camk1d PE=1 SV=2 147 403 2.0E-11
sp|Q3ULB5|PAK6_MOUSE Serine/threonine-protein kinase PAK 6 OS=Mus musculus GN=Pak6 PE=2 SV=1 135 461 3.0E-11
sp|P14616|INSRR_HUMAN Insulin receptor-related protein OS=Homo sapiens GN=INSRR PE=1 SV=2 259 467 3.0E-11
sp|Q5EG47|AAPK1_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Mus musculus GN=Prkaa1 PE=1 SV=2 150 460 3.0E-11
sp|Q8IU85|KCC1D_HUMAN Calcium/calmodulin-dependent protein kinase type 1D OS=Homo sapiens GN=CAMK1D PE=1 SV=1 147 403 3.0E-11
sp|O22932|CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11 OS=Arabidopsis thaliana GN=CIPK11 PE=1 SV=1 199 461 3.0E-11
sp|P17713|STK_HYDVU Tyrosine-protein kinase STK OS=Hydra vulgaris GN=STK PE=2 SV=1 197 456 3.0E-11
sp|Q13131|AAPK1_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Homo sapiens GN=PRKAA1 PE=1 SV=4 150 460 3.0E-11
sp|Q5RDH5|AAPK1_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragment) OS=Pongo abelii GN=PRKAA1 PE=2 SV=2 150 460 3.0E-11
sp|A8X6H4|CMK1_CAEBR Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis briggsae GN=cmk-1 PE=3 SV=3 155 399 3.0E-11
sp|Q84M93|MPK17_ARATH Mitogen-activated protein kinase 17 OS=Arabidopsis thaliana GN=MPK17 PE=2 SV=1 147 477 3.0E-11
sp|P54753|EPHB3_HUMAN Ephrin type-B receptor 3 OS=Homo sapiens GN=EPHB3 PE=1 SV=2 153 461 3.0E-11
sp|P54119|CDK1_AJECA Cyclin-dependent kinase 1 OS=Ajellomyces capsulatus GN=CDC2 PE=3 SV=1 293 459 3.0E-11
sp|Q9SMQ4|SRK2F_ARATH Serine/threonine-protein kinase SRK2F OS=Arabidopsis thaliana GN=SRK2F PE=1 SV=1 156 460 3.0E-11
sp|Q9UEW8|STK39_HUMAN STE20/SPS1-related proline-alanine-rich protein kinase OS=Homo sapiens GN=STK39 PE=1 SV=3 160 461 3.0E-11
sp|A0JM20|TYRO3_XENTR Tyrosine-protein kinase receptor TYRO3 OS=Xenopus tropicalis GN=tyro3 PE=2 SV=1 193 456 3.0E-11
sp|Q07498|EPHB3_CHICK Ephrin type-B receptor 3 (Fragment) OS=Gallus gallus GN=EPHB3 PE=2 SV=1 153 461 3.0E-11
sp|Q02779|M3K10_HUMAN Mitogen-activated protein kinase kinase kinase 10 OS=Homo sapiens GN=MAP3K10 PE=1 SV=3 153 405 3.0E-11
sp|B4QK53|PLK4_DROSI Serine/threonine-protein kinase PLK4 OS=Drosophila simulans GN=SAK PE=3 SV=1 155 461 3.0E-11
sp|P55146|TYRO3_RAT Tyrosine-protein kinase receptor TYRO3 OS=Rattus norvegicus GN=Tyro3 PE=1 SV=1 193 456 3.0E-11
sp|B4PDM5|PLK4_DROYA Serine/threonine-protein kinase PLK4 OS=Drosophila yakuba GN=SAK PE=3 SV=1 155 461 3.0E-11
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 300 461 3.0E-11
sp|O88506|STK39_RAT STE20/SPS1-related proline-alanine-rich protein kinase OS=Rattus norvegicus GN=Stk39 PE=1 SV=2 160 461 3.0E-11
sp|Q06418|TYRO3_HUMAN Tyrosine-protein kinase receptor TYRO3 OS=Homo sapiens GN=TYRO3 PE=1 SV=1 193 456 4.0E-11
sp|P15735|PHKG2_HUMAN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Homo sapiens GN=PHKG2 PE=1 SV=1 288 461 4.0E-11
sp|P55144|TYRO3_MOUSE Tyrosine-protein kinase receptor TYRO3 OS=Mus musculus GN=Tyro3 PE=1 SV=2 193 456 4.0E-11
sp|Q4KTY1|KPSH1_PINFU Serine/threonine-protein kinase H1 homolog OS=Pinctada fucata GN=PSKH1 PE=2 SV=1 126 461 4.0E-11
sp|P38070|YPK3_YEAST AGC kinase YPK3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK3 PE=1 SV=1 193 403 4.0E-11
sp|P42688|SRK2_SPOLA Tyrosine-protein kinase SRK2 (Fragment) OS=Spongilla lacustris GN=SRK2 PE=2 SV=1 197 456 4.0E-11
sp|B3NE99|PLK4_DROER Serine/threonine-protein kinase PLK4 OS=Drosophila erecta GN=SAK PE=3 SV=1 155 461 4.0E-11
sp|Q38997|KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana GN=KIN10 PE=1 SV=2 111 403 4.0E-11
sp|O57473|WEE2B_XENLA Wee1-like protein kinase 2-B OS=Xenopus laevis GN=wee2-b PE=1 SV=1 126 389 4.0E-11
sp|P53351|PLK2_MOUSE Serine/threonine-protein kinase PLK2 OS=Mus musculus GN=Plk2 PE=1 SV=1 155 543 4.0E-11
sp|Q9WTL4|INSRR_MOUSE Insulin receptor-related protein OS=Mus musculus GN=Insrr PE=1 SV=2 259 467 4.0E-11
sp|O94768|ST17B_HUMAN Serine/threonine-protein kinase 17B OS=Homo sapiens GN=STK17B PE=1 SV=1 281 483 4.0E-11
sp|Q1KL86|EPHA2_MACFA Ephrin type-A receptor 2 OS=Macaca fascicularis GN=EPHA2 PE=2 SV=1 287 461 4.0E-11
sp|Q66L42|M3K10_MOUSE Mitogen-activated protein kinase kinase kinase 10 OS=Mus musculus GN=Map3k10 PE=1 SV=2 153 405 4.0E-11
sp|P50527|STE20_SCHPO Serine/threonine-protein kinase shk1/pak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk1 PE=1 SV=2 156 461 4.0E-11
sp|Q9DB30|PHKG2_MOUSE Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Mus musculus GN=Phkg2 PE=2 SV=2 288 461 4.0E-11
sp|P29317|EPHA2_HUMAN Ephrin type-A receptor 2 OS=Homo sapiens GN=EPHA2 PE=1 SV=2 287 461 4.0E-11
sp|Q54RB7|SHKA_DICDI Dual specificity protein kinase shkA OS=Dictyostelium discoideum GN=shkA PE=2 SV=1 143 456 4.0E-11
sp|P97793|ALK_MOUSE ALK tyrosine kinase receptor OS=Mus musculus GN=Alk PE=1 SV=2 197 461 4.0E-11
sp|Q9JLM8|DCLK1_MOUSE Serine/threonine-protein kinase DCLK1 OS=Mus musculus GN=Dclk1 PE=1 SV=1 160 461 5.0E-11
sp|P08458|SPS1_YEAST Sporulation-specific protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPS1 PE=1 SV=2 153 398 5.0E-11
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 155 403 5.0E-11
sp|Q6A1A2|PDPK2_HUMAN Putative 3-phosphoinositide-dependent protein kinase 2 OS=Homo sapiens GN=PDPK2P PE=5 SV=1 289 460 5.0E-11
sp|Q54XY6|Y0019_DICDI Probable serine/threonine-protein kinase DDB_G0278521 OS=Dictyostelium discoideum GN=DDB_G0278521 PE=3 SV=1 156 466 5.0E-11
sp|P24062|IGF1R_RAT Insulin-like growth factor 1 receptor OS=Rattus norvegicus GN=Igf1r PE=2 SV=2 259 467 5.0E-11
sp|O15075|DCLK1_HUMAN Serine/threonine-protein kinase DCLK1 OS=Homo sapiens GN=DCLK1 PE=1 SV=2 160 461 5.0E-11
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 283 461 5.0E-11
sp|Q9Z1W9|STK39_MOUSE STE20/SPS1-related proline-alanine-rich protein kinase OS=Mus musculus GN=Stk39 PE=1 SV=1 160 461 5.0E-11
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 300 461 5.0E-11
sp|P49673|KAPC_ASCSU cAMP-dependent protein kinase catalytic subunit OS=Ascaris suum GN=CAPK PE=2 SV=1 156 454 5.0E-11
sp|O97143|PLK4_DROME Serine/threonine-protein kinase PLK4 OS=Drosophila melanogaster GN=SAK PE=1 SV=1 155 461 5.0E-11
sp|Q5QN75|M2K1_ORYSJ Mitogen-activated protein kinase kinase 1 OS=Oryza sativa subsp. japonica GN=MKK1 PE=1 SV=1 155 461 5.0E-11
sp|O81472|MP3K2_ARATH Mitogen-activated protein kinase kinase kinase 9 OS=Arabidopsis thaliana GN=MEKK2 PE=1 SV=1 291 461 5.0E-11
sp|P06213|INSR_HUMAN Insulin receptor OS=Homo sapiens GN=INSR PE=1 SV=4 286 467 5.0E-11
sp|Q9TXJ0|CMK1_CAEEL Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis elegans GN=cmk-1 PE=1 SV=1 155 399 5.0E-11
sp|Q9Y7T4|ATG1_SCHPO Serine/threonine-protein kinase atg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atg1 PE=1 SV=1 194 454 5.0E-11
sp|Q01389|BCK1_YEAST Serine/threonine-protein kinase BCK1/SLK1/SSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCK1 PE=1 SV=1 146 469 5.0E-11
sp|B4MXR8|PLK4_DROWI Serine/threonine-protein kinase PLK4 OS=Drosophila willistoni GN=SAK PE=3 SV=1 155 461 5.0E-11
sp|Q9R012|PLK2_RAT Serine/threonine-protein kinase PLK2 OS=Rattus norvegicus GN=Plk2 PE=1 SV=1 194 543 6.0E-11
sp|P53667|LIMK1_HUMAN LIM domain kinase 1 OS=Homo sapiens GN=LIMK1 PE=1 SV=3 150 456 6.0E-11
sp|Q6DFE0|WEE2C_XENLA Wee1-like protein kinase 2-C OS=Xenopus laevis GN=wee2-c PE=2 SV=1 126 389 6.0E-11
sp|Q9C6P3|CDPKX_ARATH Calcium-dependent protein kinase 33 OS=Arabidopsis thaliana GN=CPK33 PE=2 SV=1 147 461 6.0E-11
sp|Q05688|IGF1R_BOVIN Insulin-like growth factor 1 receptor (Fragment) OS=Bos taurus GN=IGF1R PE=2 SV=1 259 467 6.0E-11
sp|Q940A2|P2C31_ARATH Protein kinase and PP2C-like domain-containing protein OS=Arabidopsis thaliana GN=At2g40860/At2g40870 PE=2 SV=1 289 466 6.0E-11
sp|Q924X7|STK33_MOUSE Serine/threonine-protein kinase 33 OS=Mus musculus GN=Stk33 PE=1 SV=2 149 461 6.0E-11
sp|Q8I7I5|ROL3_CAEEL Protein roller-3 OS=Caenorhabditis elegans GN=rol-3 PE=1 SV=2 189 461 6.0E-11
sp|O08875|DCLK1_RAT Serine/threonine-protein kinase DCLK1 OS=Rattus norvegicus GN=Dclk1 PE=1 SV=1 160 461 6.0E-11
sp|Q54PB4|MYLKE_DICDI Probable myosin light chain kinase DDB_G0284661 OS=Dictyostelium discoideum GN=DDB_G0284661 PE=3 SV=1 144 461 6.0E-11
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 155 403 6.0E-11
sp|Q39193|SRK2I_ARATH Serine/threonine-protein kinase SRK2I OS=Arabidopsis thaliana GN=SRK2I PE=1 SV=1 150 496 6.0E-11
sp|O18209|PMY13_CAEEL Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase wee-1.3 OS=Caenorhabditis elegans GN=wee-1.3 PE=1 SV=1 145 461 7.0E-11
sp|Q1XHL7|GRK7B_DANRE G protein-coupled receptor kinase 7B OS=Danio rerio GN=grk7b PE=1 SV=2 288 433 7.0E-11
sp|Q62270|SRMS_MOUSE Tyrosine-protein kinase Srms OS=Mus musculus GN=Srms PE=2 SV=2 288 456 7.0E-11
sp|O42376|MK12_DANRE Mitogen-activated protein kinase 12 OS=Danio rerio GN=mapk12 PE=2 SV=1 199 461 7.0E-11
sp|P47817|WEE2A_XENLA Wee1-like protein kinase 2-A OS=Xenopus laevis GN=wee2-a PE=1 SV=2 126 389 7.0E-11
sp|P42681|TXK_HUMAN Tyrosine-protein kinase TXK OS=Homo sapiens GN=TXK PE=1 SV=3 150 464 7.0E-11
sp|Q75V57|SAPK9_ORYSJ Serine/threonine-protein kinase SAPK9 OS=Oryza sativa subsp. japonica GN=SAPK9 PE=2 SV=1 156 460 7.0E-11
sp|Q2KJ16|PHKG2_BOVIN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Bos taurus GN=PHKG2 PE=2 SV=1 288 461 7.0E-11
sp|Q16832|DDR2_HUMAN Discoidin domain-containing receptor 2 OS=Homo sapiens GN=DDR2 PE=1 SV=2 197 460 7.0E-11
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 155 403 2.0E-10
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 300 509 6.0E-09
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 300 461 6.0E-09
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 199 461 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0044238 primary metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0006793 phosphorus metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0044267 cellular protein metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0016301 kinase activity No
GO:0044260 cellular macromolecule metabolic process No
GO:0008144 drug binding No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0003824 catalytic activity No
GO:0016310 phosphorylation No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006464 cellular protein modification process No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0043170 macromolecule metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0019538 protein metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0006796 phosphate-containing compound metabolic process No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9539
MSLIPYHPREGREIVLRHHNSIVVRDPDSHRLEIRRTECPTCHQPLGRAPSPDRSHDRQYDRGHEYVNPDYFRML
RAGNQASVSPNGSPSPVRRLFHPALAGASPPPAAPLSDSLSDEAEFVSSAPGVGQAEGSRIRRDAFSPRYFKTFF
VEETVLGRGGKGVVLLVRHEIDGCQLGHFACKRVPVGDDHAWLEKVLIEVELLAKLSHPNLVSYRHVWLEDVQLT
RFGPSVACAFILQQYCNGGDLHQYVVGSAPREATKEELKARIRRRSKGQAEPPQNLAQAMPQLSFEDIYSLFKDI
TSGVAYLHAANYIHRDLKPSNCLLHREGGKLTCLISDFGEVQLENTVRKSTGSTGTISYCAPEVLKMDVTGRYGN
FTTKSDMFSLGMILYFMCFGRLPYRGANAIQEELEDIEQLRAEITDWKGFQDERRERPDLPTRLYKLLKKLLALD
PAERPSANEVLIAMRSETNFDGITRGDRASASSSGSRGGRVQNLDSPAPSGTPVPGQSITSPPNYGARPPHTLTD
ARKERAWKRVAATHEEASPAPPRRQPDDGLD*
Coding >Hirsu2|9539
ATGTCGCTGATCCCATATCATCCTCGCGAGGGCCGCGAGATAGTCCTCCGCCATCACAACTCCATCGTCGTTCGT
GACCCCGACTCTCACCGGCTCGAGATCCGCCGCACCGAATGTCCAACGTGCCATCAGCCTCTGGGCCGCGCCCCC
TCCCCCGATCGCTCTCACGACAGACAGTACGACAGGGGCCACGAGTACGTCAATCCAGATTACTTCCGCATGCTC
CGCGCCGGCAACCAAGCCTCCGTCTCGCCCAACGGTTCCCCCAGTCCTGTCCGCAGGCTCTTCCATCCTGCTCTC
GCCGGCGCTTCCCCGCCGCCGGCTGCGCCCCTTTCCGACTCCCTTTCCGACGAGGCAGAGTTCGTCTCGAGCGCT
CCCGGCGTGGGCCAAGCCGAGGGAAGCAGGATACGAAGGGATGCCTTCAGCCCCCGCTACTTCAAGACCTTCTTC
GTCGAGGAGACTGTCCTGGGAAGAGGAGGCAAGGGCGTCGTCTTGCTCGTCAGACACGAGATTGATGGCTGTCAG
TTGGGCCACTTCGCGTGCAAGCGTGTTCCCGTCGGCGACGACCATGCCTGGCTGGAAAAGGTCTTGATCGAGGTC
GAGCTTCTCGCCAAGCTGTCCCACCCGAACCTCGTCTCGTACCGCCACGTCTGGCTCGAGGACGTCCAGCTCACC
AGGTTTGGCCCAAGCGTAGCCTGCGCCTTCATCCTACAGCAGTACTGCAACGGTGGCGACCTCCACCAGTACGTC
GTTGGCAGCGCGCCGCGCGAGGCCACAAAGGAGGAGCTCAAGGCCCGCATCCGCCGCCGCTCCAAGGGCCAGGCG
GAGCCGCCTCAGAACCTGGCGCAGGCCATGCCCCAGCTCTCGTTCGAGGACATATACTCCCTTTTCAAGGACATC
ACCTCGGGGGTCGCCTACCTGCATGCCGCAAACTACATTCATCGCGACCTCAAGCCCAGCAACTGTCTCCTGCAT
CGAGAAGGGGGCAAGCTTACCTGCCTCATCAGCGACTTTGGCGAAGTCCAGCTCGAAAACACGGTCCGAAAATCC
ACCGGCTCTACCGGCACAATCTCCTACTGCGCCCCGGAAGTCTTGAAGATGGACGTCACCGGCCGGTACGGCAAC
TTCACCACAAAATCCGACATGTTCTCGCTTGGCATGATACTCTACTTCATGTGCTTCGGGAGGCTACCCTACCGG
GGGGCCAACGCCATCCAGGAGGAGCTCGAGGATATCGAGCAGCTTCGGGCTGAGATTACCGATTGGAAGGGCTTC
CAAGACGAGCGGAGAGAGCGCCCGGACCTGCCGACTCGCCTGTACAAACTGCTGAAGAAGCTGCTGGCCCTGGAC
CCGGCCGAGCGCCCGAGCGCAAATGAGGTGTTGATCGCCATGAGAAGCGAGACCAATTTCGATGGCATCACGAGG
GGAGACAGGGCCTCGGCTTCATCTTCCGGCTCCCGTGGTGGCCGGGTACAGAACCTCGACTCTCCGGCACCCTCC
GGCACCCCCGTTCCCGGCCAGTCCATCACATCGCCGCCCAACTACGGGGCGCGCCCACCTCATACTCTCACAGAC
GCTCGGAAGGAGAGAGCGTGGAAGCGCGTGGCCGCCACACACGAGGAGGCGAGCCCCGCGCCACCTCGTCGGCAG
CCCGACGACGGACTCGACTGA
Transcript >Hirsu2|9539
ATGTCGCTGATCCCATATCATCCTCGCGAGGGCCGCGAGATAGTCCTCCGCCATCACAACTCCATCGTCGTTCGT
GACCCCGACTCTCACCGGCTCGAGATCCGCCGCACCGAATGTCCAACGTGCCATCAGCCTCTGGGCCGCGCCCCC
TCCCCCGATCGCTCTCACGACAGACAGTACGACAGGGGCCACGAGTACGTCAATCCAGATTACTTCCGCATGCTC
CGCGCCGGCAACCAAGCCTCCGTCTCGCCCAACGGTTCCCCCAGTCCTGTCCGCAGGCTCTTCCATCCTGCTCTC
GCCGGCGCTTCCCCGCCGCCGGCTGCGCCCCTTTCCGACTCCCTTTCCGACGAGGCAGAGTTCGTCTCGAGCGCT
CCCGGCGTGGGCCAAGCCGAGGGAAGCAGGATACGAAGGGATGCCTTCAGCCCCCGCTACTTCAAGACCTTCTTC
GTCGAGGAGACTGTCCTGGGAAGAGGAGGCAAGGGCGTCGTCTTGCTCGTCAGACACGAGATTGATGGCTGTCAG
TTGGGCCACTTCGCGTGCAAGCGTGTTCCCGTCGGCGACGACCATGCCTGGCTGGAAAAGGTCTTGATCGAGGTC
GAGCTTCTCGCCAAGCTGTCCCACCCGAACCTCGTCTCGTACCGCCACGTCTGGCTCGAGGACGTCCAGCTCACC
AGGTTTGGCCCAAGCGTAGCCTGCGCCTTCATCCTACAGCAGTACTGCAACGGTGGCGACCTCCACCAGTACGTC
GTTGGCAGCGCGCCGCGCGAGGCCACAAAGGAGGAGCTCAAGGCCCGCATCCGCCGCCGCTCCAAGGGCCAGGCG
GAGCCGCCTCAGAACCTGGCGCAGGCCATGCCCCAGCTCTCGTTCGAGGACATATACTCCCTTTTCAAGGACATC
ACCTCGGGGGTCGCCTACCTGCATGCCGCAAACTACATTCATCGCGACCTCAAGCCCAGCAACTGTCTCCTGCAT
CGAGAAGGGGGCAAGCTTACCTGCCTCATCAGCGACTTTGGCGAAGTCCAGCTCGAAAACACGGTCCGAAAATCC
ACCGGCTCTACCGGCACAATCTCCTACTGCGCCCCGGAAGTCTTGAAGATGGACGTCACCGGCCGGTACGGCAAC
TTCACCACAAAATCCGACATGTTCTCGCTTGGCATGATACTCTACTTCATGTGCTTCGGGAGGCTACCCTACCGG
GGGGCCAACGCCATCCAGGAGGAGCTCGAGGATATCGAGCAGCTTCGGGCTGAGATTACCGATTGGAAGGGCTTC
CAAGACGAGCGGAGAGAGCGCCCGGACCTGCCGACTCGCCTGTACAAACTGCTGAAGAAGCTGCTGGCCCTGGAC
CCGGCCGAGCGCCCGAGCGCAAATGAGGTGTTGATCGCCATGAGAAGCGAGACCAATTTCGATGGCATCACGAGG
GGAGACAGGGCCTCGGCTTCATCTTCCGGCTCCCGTGGTGGCCGGGTACAGAACCTCGACTCTCCGGCACCCTCC
GGCACCCCCGTTCCCGGCCAGTCCATCACATCGCCGCCCAACTACGGGGCGCGCCCACCTCATACTCTCACAGAC
GCTCGGAAGGAGAGAGCGTGGAAGCGCGTGGCCGCCACACACGAGGAGGCGAGCCCCGCGCCACCTCGTCGGCAG
CCCGACGACGGACTCGACTGA
Gene >Hirsu2|9539
ATGTCGCTGATCCCATATCATCCTCGCGAGGGCCGCGAGATAGTCCTGTTCGTCTCCCCAGCCGCTCCCCGCCGG
TAGGCCCTCGCTGACTGCTCACCACCCAGCCGCCATCACAACTCCATCGTCGTTCGTGACCCCGACTCTCACCGG
CTCGAGATCCGCCGCACCGAATGTCCAACGTGCCATCAGCCTCTGGGCCGCGCCCCCTCCCCCGATCGCTCTCAC
GACAGACAGTACGACAGGGGCCACGAGTACGTCAATCCAGATTACTTCCGCATGCTCCGCGCCGGCAACCAAGCC
TCCGTCTCGCCCAACGGTTCCCCCAGTCCTGTCCGCAGGCTCTTCCATCCTGCTCTCGCCGGCGCTTCCCCGCCG
CCGGCTGCGCCCCTTTCCGACTCCCTTTCCGACGAGGCAGAGTTCGTCTCGAGCGCTCCCGGCGTGGGCCAAGCC
GAGGGAAGCAGGATACGAAGGGATGCCTTCAGCCCCCGCTACTTCAAGACCTTCTTCGTCGAGGAGACTGTCCTG
GGAAGAGGAGGCAAGGGCGTCGTCTTGCTCGTCAGACACGAGATTGATGGCTGTCAGTTGGGCCACTTCGCGTGC
AAGCGTGTTCCCGTCGGCGACGACCATGCCTGGCTGGAAAAGGTCTTGATCGAGGTCGAGCTTCTCGCCAAGCTG
TCCCACCCGAACCTCGTCTCGTACCGCCACGTCTGGCTCGAGGACGTCCAGCTCACCAGGTTTGGCCCAAGCGTA
GCCTGCGCCTTCATCCTACAGCAGTACTGCAACGGTGGCGACCTCCACCAGTACGTCGTTGGCAGCGCGCCGCGC
GAGGCCACAAAGGAGGAGCTCAAGGCCCGCATCCGCCGCCGCTCCAAGGGCCAGGCGGAGCCGCCTCAGAACCTG
GCGCAGGCCATGCCCCAGCTCTCGTTCGAGGACATATACTCCCTTTTCAAGGACATCACCTCGGGGGTCGCCTAC
CTGCATGCCGCAAACTACATTCATCGCGACCTCAAGCCCAGCAACTGTCTCCTGCATCGAGAAGGGGGCAAGCTT
ACCTGCCTCATCAGCGACTTTGGCGAAGTCCAGCTCGAAAACACGGTCCGAAAATCCACCGGCTCTACCGGCACA
ATCTCCTACTGCGCCCCGGAAGTCTTGAAGATGGACGTCACCGGCCGGTACGGCAACTTCACCACAAAATCCGAC
ATGTTCTCGCTTGGCATGATACTCTACTTCATGTGCTTCGGGAGGCTACCCTACCGGGGGGCCAACGCCATCCAG
GAGGAGCTCGAGGATATCGAGCAGCTTCGGGCTGAGATTACCGATTGGAAGGGCTTCCAAGACGAGCGGAGAGAG
CGCCCGGACCTGCCGACTCGCCTGTACAAACTGCTGAAGAAGCTGCTGGCCCTGGACCCGGCCGAGCGCCCGAGC
GCAAATGAGGTGTTGATCGCCATGAGAAGCGAGACCAATTTCGATGGCATCACGAGGGGAGACAGGGCCTCGGCT
TCATCTTCCGGCTCCCGTGGTGGCCGGGTACAGAACCTCGACTCTCCGGCACCCTCCGGCACCCCCGTTCCCGGC
CAGTCCATCACATCGCCGCCCAACTACGGGGCGCGCCCACCTCATACTCTCACAGACGCTCGGAAGGAGAGAGCG
TGGAAGCGCGTGGCCGCCACACACGAGGAGGCGAGCCCGTGGCCCGGGCCCGACGGCGGCGACGGCGGACCGCGG
CTGGATGGAGACGCAACCACACACACTCTGTCCCACCGCGGCAGCTTCGCCACACACGCCGGGGACGAGACCGGT
GCAGCGCGCCACCTCGTCGGCAGCCCGACGACGGACTCGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail