Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9538
Gene name
LocationContig_7:58297..59834
Strand+
Gene length (bp)1537
Transcript length (bp)1272
Coding sequence length (bp)1272
Protein length (aa) 424

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06516 NUP Purine nucleoside permease (NUP) 7.0E-132 51 374

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O93844|NUP_CANAX Purine nucleoside permease OS=Candida albicans GN=NUP PE=3 SV=1 48 398 4.0E-88
sp|Q5AGW8|NUP_CANAL Purine nucleoside permease OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NUP PE=1 SV=1 48 398 9.0E-88
sp|O74493|NUP_SCHPO Probable purine nucleoside permease C285.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC285.05 PE=3 SV=1 48 366 4.0E-71

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9538
MPPRASLLFARAQSVCLRLLSVCLRLPLFALHHYHDVSAAAVSPDGGLIAPRVMIVSMWTPEASAWHSRFHESDL
GNLSAVAVTVPGLSMLFPHVLCTADGRVCQLTVGEGEINAAASMMALVLSSHFDLGQTYFLIAGIAGVNPRHATL
GSVALARFAVQAALQSEIDPRSLPANWTTSYIPYGRDRPFQYPTVTYGTEVFEVNDGLRHAAFLLASRATLADDD
ASRRYRALYAADGQGRYAKATQPPAVAKCDCTTSDVYYSGTILSQVFERTTEVWTNGTGVYCMAAQEDNATLEVL
VRAAVQRTLDFSRVILLRAGSDFDRPPPGVSDWHHLTRVDQNGFATALDNMYRAGIEIVKGLVADWNSTFRRGIA
PSNYLGDILGSLGGSPDFGPGSITGGKPVEPAGAGGYCDKRRRRRHRR*
Coding >Hirsu2|9538
ATGCCGCCCCGAGCCTCATTGCTGTTTGCGCGAGCGCAGTCTGTCTGCCTCCGACTGCTGTCCGTCTGCCTCCGT
CTGCCGCTCTTCGCCCTCCACCACTACCACGACGTCTCTGCGGCCGCCGTCTCTCCCGACGGCGGCCTCATTGCG
CCTCGCGTCATGATCGTATCCATGTGGACACCCGAGGCCAGCGCGTGGCATTCCCGCTTCCATGAGTCCGACCTC
GGCAATTTGTCCGCCGTCGCCGTCACCGTGCCCGGCCTTTCCATGCTCTTCCCGCACGTCCTCTGCACCGCCGAC
GGCCGCGTCTGCCAGTTGACCGTCGGCGAGGGGGAGATCAACGCCGCCGCGTCCATGATGGCTCTCGTCCTGTCC
TCGCATTTCGACCTCGGCCAGACCTACTTCCTCATCGCCGGCATCGCCGGCGTGAACCCCCGGCACGCCACGCTC
GGCAGCGTCGCCCTCGCCCGCTTCGCCGTCCAGGCCGCCCTCCAGTCCGAGATCGATCCGCGCTCCTTGCCGGCC
AACTGGACGACAAGCTACATCCCCTACGGCCGCGACCGGCCCTTCCAGTATCCCACCGTCACCTACGGCACCGAG
GTCTTCGAGGTCAACGACGGCCTCCGCCACGCCGCCTTCCTTCTCGCCTCCAGGGCCACCCTGGCCGACGACGAC
GCCTCGCGCCGCTACCGCGCCCTCTACGCCGCGGACGGACAGGGCCGCTACGCCAAGGCCACCCAGCCCCCGGCC
GTGGCCAAGTGTGACTGCACCACCAGTGACGTTTACTACTCCGGCACCATCTTGTCCCAGGTCTTTGAGAGGACG
ACCGAGGTCTGGACCAACGGCACCGGCGTCTATTGCATGGCTGCCCAGGAAGACAACGCCACGCTCGAGGTGCTC
GTGAGGGCCGCCGTGCAGCGCACTCTCGACTTTTCCCGCGTCATCTTGTTGCGCGCAGGCTCCGATTTCGACCGC
CCCCCGCCCGGCGTGTCAGACTGGCATCACCTCACCCGCGTCGATCAAAACGGATTTGCAACTGCCCTCGACAAC
ATGTACCGTGCGGGCATCGAGATTGTCAAGGGCCTGGTCGCCGACTGGAACTCGACCTTCCGCCGCGGCATCGCG
CCCTCCAACTACCTCGGCGACATCTTGGGCAGCCTCGGCGGCTCTCCCGATTTCGGGCCCGGCAGCATCACGGGC
GGCAAGCCGGTCGAGCCGGCCGGCGCCGGCGGCTACTGCGACAAGCGCCGCCGCCGCCGCCACAGGCGTTGA
Transcript >Hirsu2|9538
ATGCCGCCCCGAGCCTCATTGCTGTTTGCGCGAGCGCAGTCTGTCTGCCTCCGACTGCTGTCCGTCTGCCTCCGT
CTGCCGCTCTTCGCCCTCCACCACTACCACGACGTCTCTGCGGCCGCCGTCTCTCCCGACGGCGGCCTCATTGCG
CCTCGCGTCATGATCGTATCCATGTGGACACCCGAGGCCAGCGCGTGGCATTCCCGCTTCCATGAGTCCGACCTC
GGCAATTTGTCCGCCGTCGCCGTCACCGTGCCCGGCCTTTCCATGCTCTTCCCGCACGTCCTCTGCACCGCCGAC
GGCCGCGTCTGCCAGTTGACCGTCGGCGAGGGGGAGATCAACGCCGCCGCGTCCATGATGGCTCTCGTCCTGTCC
TCGCATTTCGACCTCGGCCAGACCTACTTCCTCATCGCCGGCATCGCCGGCGTGAACCCCCGGCACGCCACGCTC
GGCAGCGTCGCCCTCGCCCGCTTCGCCGTCCAGGCCGCCCTCCAGTCCGAGATCGATCCGCGCTCCTTGCCGGCC
AACTGGACGACAAGCTACATCCCCTACGGCCGCGACCGGCCCTTCCAGTATCCCACCGTCACCTACGGCACCGAG
GTCTTCGAGGTCAACGACGGCCTCCGCCACGCCGCCTTCCTTCTCGCCTCCAGGGCCACCCTGGCCGACGACGAC
GCCTCGCGCCGCTACCGCGCCCTCTACGCCGCGGACGGACAGGGCCGCTACGCCAAGGCCACCCAGCCCCCGGCC
GTGGCCAAGTGTGACTGCACCACCAGTGACGTTTACTACTCCGGCACCATCTTGTCCCAGGTCTTTGAGAGGACG
ACCGAGGTCTGGACCAACGGCACCGGCGTCTATTGCATGGCTGCCCAGGAAGACAACGCCACGCTCGAGGTGCTC
GTGAGGGCCGCCGTGCAGCGCACTCTCGACTTTTCCCGCGTCATCTTGTTGCGCGCAGGCTCCGATTTCGACCGC
CCCCCGCCCGGCGTGTCAGACTGGCATCACCTCACCCGCGTCGATCAAAACGGATTTGCAACTGCCCTCGACAAC
ATGTACCGTGCGGGCATCGAGATTGTCAAGGGCCTGGTCGCCGACTGGAACTCGACCTTCCGCCGCGGCATCGCG
CCCTCCAACTACCTCGGCGACATCTTGGGCAGCCTCGGCGGCTCTCCCGATTTCGGGCCCGGCAGCATCACGGGC
GGCAAGCCGGTCGAGCCGGCCGGCGCCGGCGGCTACTGCGACAAGCGCCGCCGCCGCCGCCACAGGCGTTGA
Gene >Hirsu2|9538
ATGCCGCCCCGAGCCTCATTGCTGTTTGCGCGAGCGCAGTCTGTCTGCCTCCGACTGCTGTCCGTCTGCCTCCGT
CTGCCGCTCTTCGCCCTCCACCACTACCACGACGTCTCTGCGGCCGCCGTCTCTCCCGACGGCGGCCTCATTGCG
CCTCGCGTCATGATCGTATCCATGGCACGTCGTCTCTCCCCCCTCCTCCCCTCGCCCGAACCATGTACACGTATT
ACTCCGAGCCGGTCCGTCTAACTTGTGTCCTCCCACTTCTTCTTCTCCCTCCCCCCCTCCCCCTCTCGCTCTCTC
TCTCTCTCCTCCTCCTCTGTGCATCTACAGTGGACACCCGAGGCCAGCGCGTGGCATTCCCGCTTCCATGAGTCC
GACCTCGGCAATTTGTCCGCCGTCGCCGTCACCGTGCCCGGCCTTTCCATGCTCTTCCCGCACGTCCTCTGCACC
GCCGACGGCCGCGTCTGCCAGTTGACCGTCGGCGAGGGGGAGATCAACGCCGCCGCGTCCATGATGGCTCTCGTC
CTGTCCTCGCATTTCGACCTCGGCCAGACCTACTTCCTCATCGCCGGCATCGCCGGCGTGAACCCCCGGCACGCC
ACGCTCGGCAGCGTCGCCCTCGCCCGCTTCGCCGTCCAGGCCGCCCTCCAGTCCGAGATCGATCCGCGCTCCTTG
CCGGCCAACTGGACGACAAGCTACATCCCCTACGGCCGCGACCGGCCCTTCCAGTATCCCACCGTCACCTACGGC
ACCGAGGTCTTCGAGGTCAACGACGGCCTCCGCCACGCCGCCTTCCTTCTCGCCTCCAGGGCCACCCTGGCCGAC
GACGACGCCTCGCGCCGCTACCGCGCCCTCTACGCCGCGGACGGACAGGGCCGCTACGCCAAGGCCACCCAGCCC
CCGGCCGTGGCCAAGTGTGACTGCACCACCAGTGACGTTTACTACTCCGGCACCATCTTGTCCCAGGTCTTTGAG
AGGACGACCGAGGTCTGGACCAACGGCACCGGCGTCTATTGCATGGCTGCCCAGGAAGACAACGCCACGCTCGAG
GTGCTCGTGAGGGCCGCCGTGCAGCGCACTCTCGACTTTTCCCGCGTCATCTTGTTGCGCGCAGGTACGGACGAC
GGGAAGCGCTGGGAGGGGAGGCGAGGGAGCCGTCGAGCGCCGCCGGACCACGTGGGACGAGAATAGCTGACCAGA
CGTGCGGCCGAGCTGGCTTGCAGGCTCCGATTTCGACCGCCCCCCGCCCGGCGTGTCAGACTGGCATCACCTCAC
CCGCGTCGATCAAAACGGATTTGCAACTGCCCTCGACAACATGTACCGTGCGGGCATCGAGATTGTCAAGGGCCT
GGTCGCCGACTGGAACTCGACCTTCCGCCGCGGCATCGCGCCCTCCAACTACCTCGGCGACATCTTGGGCAGCCT
CGGCGGCTCTCCCGATTTCGGGCCCGGCAGCATCACGGGCGGCAAGCCGGTCGAGCCGGCCGGCGCCGGCGGCTA
CTGCGACAAGCGCCGCCGCCGCCGCCACAGGCGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail