Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|951
Gene name
LocationContig_12:15248..16487
Strand-
Gene length (bp)1239
Transcript length (bp)1239
Coding sequence length (bp)1239
Protein length (aa) 413

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.5E-38 67 394
PF00083 Sugar_tr Sugar (and other) transporter 1.1E-15 92 244
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 6.1E-10 49 252

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 45 398 9.0E-59
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 8 398 1.0E-57
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 29 392 5.0E-55
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 42 399 5.0E-54
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 38 398 2.0E-53
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 45 398 9.0E-59
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 8 398 1.0E-57
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 29 392 5.0E-55
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 42 399 5.0E-54
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 38 398 2.0E-53
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 43 398 6.0E-53
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 38 398 3.0E-52
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 38 398 3.0E-52
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 42 398 1.0E-51
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 43 397 3.0E-51
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 44 392 2.0E-50
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 44 394 1.0E-47
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 42 392 3.0E-47
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 28 398 3.0E-44
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 14 396 1.0E-43
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 44 394 2.0E-41
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 44 394 6.0E-40
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 44 394 6.0E-40
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 4 394 3.0E-39
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 43 394 9.0E-38
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 44 398 4.0E-37
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 44 394 4.0E-33
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 45 396 2.0E-30
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 45 396 3.0E-29
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 45 396 3.0E-29
sp|O59833|YCUD_SCHPO Uncharacterized transporter C965.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.13 PE=3 SV=1 21 394 5.0E-28
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 8 392 8.0E-26
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 4 394 1.0E-23
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 81 236 2.0E-18
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 14 236 1.0E-16
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 81 360 5.0E-12
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 73 269 1.0E-11
sp|B0JZE1|SPNS2_XENTR Protein spinster homolog 2 OS=Xenopus tropicalis GN=spns2 PE=2 SV=1 39 250 7.0E-11
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 47 233 2.0E-10
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 44 241 3.0E-10
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 42 233 2.0E-09
sp|Q9GQQ0|SPIN_DROME Protein spinster OS=Drosophila melanogaster GN=spin PE=1 SV=1 78 235 3.0E-09
sp|P9WJY3|MFS55_MYCTU MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1410c PE=1 SV=1 100 233 3.0E-09
sp|P9WJY2|MFS55_MYCTO MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1454 PE=3 SV=1 100 233 3.0E-09
sp|C6DTH3|MFS55_MYCTK MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain KZN 1435 / MDR) GN=TBMG_02570 PE=3 SV=1 100 233 3.0E-09
sp|A5WM93|MFS55_MYCTF MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain F11) GN=TBFG_11439 PE=3 SV=1 100 233 3.0E-09
sp|A5U2B2|MFS55_MYCTA MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=MRA_1419 PE=3 SV=1 100 233 3.0E-09
sp|C1AN55|MFS55_MYCBT MFS-type drug efflux transporter P55 OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=JTY_1446 PE=3 SV=1 100 233 3.0E-09
sp|A1KIJ9|MFS55_MYCBP MFS-type drug efflux transporter P55 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_1471c PE=1 SV=1 100 233 3.0E-09
sp|Q7U042|MFS55_MYCBO MFS-type drug efflux transporter P55 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1445c PE=3 SV=1 100 233 3.0E-09
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 44 241 3.0E-09
sp|Q9CCP7|MFS55_MYCLE MFS-type drug efflux transporter P55 OS=Mycobacterium leprae (strain TN) GN=ML0556 PE=3 SV=1 100 233 3.0E-09
sp|P42670|PUR8_STRAD Puromycin resistance protein pur8 OS=Streptomyces alboniger GN=pur8 PE=3 SV=1 53 219 6.0E-09
sp|Q0GQS6|PBUE_BACAM Purine efflux pump PbuE OS=Bacillus amyloliquefaciens GN=pbuE PE=1 SV=1 78 278 6.0E-09
sp|P45123|BCR_HAEIN Bicyclomycin resistance protein homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bcr PE=3 SV=1 81 262 9.0E-09
sp|Q797E3|PBUE_BACSU Purine efflux pump PbuE OS=Bacillus subtilis (strain 168) GN=pbuE PE=1 SV=1 78 252 9.0E-09
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 103 247 1.0E-08
sp|A2CER7|SPNS3_DANRE Protein spinster homolog 3 OS=Danio rerio GN=spns3 PE=2 SV=1 43 214 2.0E-08
sp|P44927|EMRB_HAEIN Multidrug export protein EmrB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=emrB PE=3 SV=1 68 248 3.0E-08
sp|P96709|YDGK_BACSU Uncharacterized MFS-type transporter YdgK OS=Bacillus subtilis (strain 168) GN=ydgK PE=3 SV=1 81 223 4.0E-08
sp|A8ACM0|MDTL_CITK8 Multidrug resistance protein MdtL OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mdtL PE=3 SV=1 82 253 7.0E-08
sp|P40475|QDR1_YEAST Quinidine resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR1 PE=1 SV=1 35 236 1.0E-07
sp|Q43975|PCAK_ACIAD 4-hydroxybenzoate transporter PcaK OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pcaK PE=1 SV=3 83 284 2.0E-07
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 54 220 2.0E-07
sp|Q9SX48|STP9_ARATH Sugar transport protein 9 OS=Arabidopsis thaliana GN=STP9 PE=1 SV=1 78 296 2.0E-07
sp|Q99S97|SDRM_STAAN Multidrug efflux pump SdrM OS=Staphylococcus aureus (strain N315) GN=sdrM PE=1 SV=1 56 217 3.0E-07
sp|P94574|YWOD_BACSU Uncharacterized MFS-type transporter YwoD OS=Bacillus subtilis (strain 168) GN=ywoD PE=3 SV=1 54 222 3.0E-07
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 17 254 4.0E-07
sp|P46333|CSBC_BACSU Probable metabolite transport protein CsbC OS=Bacillus subtilis (strain 168) GN=csbC PE=1 SV=3 73 274 4.0E-07
sp|Q59YT1|QDR2_CANAL MFS antiporter QDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR2 PE=3 SV=1 45 396 4.0E-07
sp|B5XZP2|MDTL_KLEP3 Multidrug resistance protein MdtL OS=Klebsiella pneumoniae (strain 342) GN=mdtL PE=3 SV=1 82 240 5.0E-07
sp|Q7ZU13|SPNS1_DANRE Protein spinster homolog 1 OS=Danio rerio GN=spns1 PE=2 SV=1 78 214 6.0E-07
sp|Q9H2V7|SPNS1_HUMAN Protein spinster homolog 1 OS=Homo sapiens GN=SPNS1 PE=1 SV=1 25 216 9.0E-07
sp|Q51955|PCAK_PSEPU 4-hydroxybenzoate transporter PcaK OS=Pseudomonas putida GN=pcaK PE=1 SV=1 83 266 9.0E-07
sp|Q5XGK0|SPNS1_XENLA Protein spinster homolog 1 OS=Xenopus laevis GN=spns1 PE=2 SV=1 78 214 1.0E-06
sp|P37498|YYBF_BACSU Uncharacterized MFS-type transporter YybF OS=Bacillus subtilis (strain 168) GN=yybF PE=3 SV=1 86 213 1.0E-06
sp|P39637|YWFA_BACSU Uncharacterized MFS-type transporter YwfA OS=Bacillus subtilis (strain 168) GN=ywfA PE=3 SV=1 44 223 1.0E-06
sp|Q9I6Q3|PCAK_PSEAE 4-hydroxybenzoate transporter PcaK OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pcaK PE=3 SV=1 40 209 2.0E-06
sp|O31577|YFHI_BACSU Uncharacterized MFS-type transporter YfhI OS=Bacillus subtilis (strain 168) GN=yfhI PE=3 SV=1 77 216 2.0E-06
sp|A6TG19|MDTL_KLEP7 Multidrug resistance protein MdtL OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mdtL PE=3 SV=1 82 275 2.0E-06
sp|O35018|LMRB_BACSU Lincomycin resistance protein LmrB OS=Bacillus subtilis (strain 168) GN=lmrB PE=3 SV=1 73 222 2.0E-06
sp|O31563|YFIU_BACSU Uncharacterized MFS-type transporter YfiU OS=Bacillus subtilis (strain 168) GN=yfiU PE=3 SV=1 68 249 2.0E-06
sp|B7M562|MDTL_ECO8A Multidrug resistance protein MdtL OS=Escherichia coli O8 (strain IAI1) GN=mdtL PE=3 SV=1 82 253 4.0E-06
sp|A7ZTR5|MDTL_ECO24 Multidrug resistance protein MdtL OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mdtL PE=3 SV=1 82 253 4.0E-06
sp|O52733|XYLT_LACBR D-xylose-proton symporter OS=Lactobacillus brevis GN=xylT PE=3 SV=1 73 236 4.0E-06
sp|P0AEJ0|EMRB_ECOLI Multidrug export protein EmrB OS=Escherichia coli (strain K12) GN=emrB PE=1 SV=1 58 229 8.0E-06
sp|P0AEJ1|EMRB_ECO57 Multidrug export protein EmrB OS=Escherichia coli O157:H7 GN=emrB PE=3 SV=1 58 229 8.0E-06
sp|O34307|YVMA_BACSU Uncharacterized MFS-type transporter YvmA OS=Bacillus subtilis (strain 168) GN=yvmA PE=3 SV=1 71 337 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

Domain # Start End Length
1 64 86 22
2 96 118 22
3 125 147 22
4 151 173 22
5 186 208 22
6 212 234 22
7 283 305 22
8 325 347 22
9 374 391 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|951
MARIEPVASALSTSKAPGTVELGRAETRNAPFLSDDGYLAFSPDDPDNPQNWPNSRRVTVTAATVLLVLNATFAS
SAISGAFPSISKEFHVSITAAGLTVTLFLVGYCAGPLFFAPLSEFYGRRWIFYSTFILYIIFNFLCAFAPNFGGL
LVGRLITGTLVSAPLSNAPGVLADLWNPIERGNAMAGFAASIWAGSALGPVVGGFIQLKKDWQWVFYTQLMFGGA
TALVMFLIPETHGPTVLRAKAKKIREQQIPGYENIKAPADDADRSLANIFGIALTRPWIILFDPISFFCAIYLSV
IYTLLYMLFEIYPIVFHLKRGWNAGVAELPLLGTIVGVVIGGGLIVLDTRKRANKIKRGERTLQDFEPEERLDLA
MVGGIGFAIAMFWFAWTGEYKYVPEESAPDPENDTVC*
Coding >Hirsu2|951
ATGGCGAGAATAGAACCGGTCGCTTCCGCCTTATCGACCAGCAAGGCTCCCGGGACTGTTGAACTTGGCCGGGCC
GAGACCAGAAACGCGCCGTTCCTCAGCGACGATGGATACCTCGCCTTCAGCCCCGATGACCCAGACAACCCTCAA
AATTGGCCCAACTCTCGTCGAGTGACCGTGACCGCGGCCACCGTTCTTCTGGTTCTCAACGCGACATTTGCCTCG
AGTGCCATCAGCGGCGCATTCCCGTCTATATCCAAGGAGTTCCACGTTTCCATCACCGCGGCGGGACTGACTGTT
ACGCTCTTTCTCGTCGGCTATTGCGCGGGCCCCTTATTCTTTGCGCCGTTGAGCGAGTTCTATGGCCGACGATGG
ATTTTCTACAGCACCTTCATCCTATATATCATCTTCAACTTTCTCTGTGCCTTTGCCCCGAACTTCGGGGGCCTG
CTCGTCGGCAGGCTAATCACCGGCACTCTTGTCTCAGCGCCTCTTAGCAACGCGCCGGGGGTTTTGGCTGACCTA
TGGAACCCGATCGAACGAGGTAACGCCATGGCGGGATTTGCGGCCTCGATCTGGGCAGGCTCTGCGCTTGGTCCC
GTCGTCGGTGGCTTCATCCAGCTGAAGAAGGATTGGCAATGGGTCTTTTATACCCAACTGATGTTCGGCGGGGCG
ACGGCCCTTGTTATGTTTTTGATTCCCGAAACCCATGGTCCGACGGTATTGCGCGCGAAGGCGAAAAAGATTCGA
GAGCAACAAATACCTGGCTACGAAAACATCAAGGCTCCAGCTGATGATGCCGACCGGTCACTCGCCAATATCTTC
GGAATTGCGCTTACACGCCCGTGGATTATTCTCTTCGACCCGATATCCTTCTTCTGCGCCATTTATCTCTCGGTT
ATTTACACGCTTCTGTATATGCTTTTCGAGATTTACCCTATCGTGTTCCACCTTAAGCGTGGGTGGAACGCAGGC
GTCGCCGAATTGCCCTTACTTGGAACCATTGTCGGCGTTGTCATCGGTGGAGGTCTAATCGTACTGGATACGAGG
AAGCGTGCCAACAAGATCAAGCGAGGAGAAAGGACGCTACAAGATTTCGAGCCAGAAGAGCGCCTGGATCTAGCC
ATGGTTGGTGGTATCGGCTTTGCCATCGCCATGTTCTGGTTTGCTTGGACTGGGGAGTACAAGTACGTGCCCGAA
GAATCTGCCCCTGATCCTGAGAACGATACCGTATGCTGA
Transcript >Hirsu2|951
ATGGCGAGAATAGAACCGGTCGCTTCCGCCTTATCGACCAGCAAGGCTCCCGGGACTGTTGAACTTGGCCGGGCC
GAGACCAGAAACGCGCCGTTCCTCAGCGACGATGGATACCTCGCCTTCAGCCCCGATGACCCAGACAACCCTCAA
AATTGGCCCAACTCTCGTCGAGTGACCGTGACCGCGGCCACCGTTCTTCTGGTTCTCAACGCGACATTTGCCTCG
AGTGCCATCAGCGGCGCATTCCCGTCTATATCCAAGGAGTTCCACGTTTCCATCACCGCGGCGGGACTGACTGTT
ACGCTCTTTCTCGTCGGCTATTGCGCGGGCCCCTTATTCTTTGCGCCGTTGAGCGAGTTCTATGGCCGACGATGG
ATTTTCTACAGCACCTTCATCCTATATATCATCTTCAACTTTCTCTGTGCCTTTGCCCCGAACTTCGGGGGCCTG
CTCGTCGGCAGGCTAATCACCGGCACTCTTGTCTCAGCGCCTCTTAGCAACGCGCCGGGGGTTTTGGCTGACCTA
TGGAACCCGATCGAACGAGGTAACGCCATGGCGGGATTTGCGGCCTCGATCTGGGCAGGCTCTGCGCTTGGTCCC
GTCGTCGGTGGCTTCATCCAGCTGAAGAAGGATTGGCAATGGGTCTTTTATACCCAACTGATGTTCGGCGGGGCG
ACGGCCCTTGTTATGTTTTTGATTCCCGAAACCCATGGTCCGACGGTATTGCGCGCGAAGGCGAAAAAGATTCGA
GAGCAACAAATACCTGGCTACGAAAACATCAAGGCTCCAGCTGATGATGCCGACCGGTCACTCGCCAATATCTTC
GGAATTGCGCTTACACGCCCGTGGATTATTCTCTTCGACCCGATATCCTTCTTCTGCGCCATTTATCTCTCGGTT
ATTTACACGCTTCTGTATATGCTTTTCGAGATTTACCCTATCGTGTTCCACCTTAAGCGTGGGTGGAACGCAGGC
GTCGCCGAATTGCCCTTACTTGGAACCATTGTCGGCGTTGTCATCGGTGGAGGTCTAATCGTACTGGATACGAGG
AAGCGTGCCAACAAGATCAAGCGAGGAGAAAGGACGCTACAAGATTTCGAGCCAGAAGAGCGCCTGGATCTAGCC
ATGGTTGGTGGTATCGGCTTTGCCATCGCCATGTTCTGGTTTGCTTGGACTGGGGAGTACAAGTACGTGCCCGAA
GAATCTGCCCCTGATCCTGAGAACGATACCGTATGCTGA
Gene >Hirsu2|951
ATGGCGAGAATAGAACCGGTCGCTTCCGCCTTATCGACCAGCAAGGCTCCCGGGACTGTTGAACTTGGCCGGGCC
GAGACCAGAAACGCGCCGTTCCTCAGCGACGATGGATACCTCGCCTTCAGCCCCGATGACCCAGACAACCCTCAA
AATTGGCCCAACTCTCGTCGAGTGACCGTGACCGCGGCCACCGTTCTTCTGGTTCTCAACGCGACATTTGCCTCG
AGTGCCATCAGCGGCGCATTCCCGTCTATATCCAAGGAGTTCCACGTTTCCATCACCGCGGCGGGACTGACTGTT
ACGCTCTTTCTCGTCGGCTATTGCGCGGGCCCCTTATTCTTTGCGCCGTTGAGCGAGTTCTATGGCCGACGATGG
ATTTTCTACAGCACCTTCATCCTATATATCATCTTCAACTTTCTCTGTGCCTTTGCCCCGAACTTCGGGGGCCTG
CTCGTCGGCAGGCTAATCACCGGCACTCTTGTCTCAGCGCCTCTTAGCAACGCGCCGGGGGTTTTGGCTGACCTA
TGGAACCCGATCGAACGAGGTAACGCCATGGCGGGATTTGCGGCCTCGATCTGGGCAGGCTCTGCGCTTGGTCCC
GTCGTCGGTGGCTTCATCCAGCTGAAGAAGGATTGGCAATGGGTCTTTTATACCCAACTGATGTTCGGCGGGGCG
ACGGCCCTTGTTATGTTTTTGATTCCCGAAACCCATGGTCCGACGGTATTGCGCGCGAAGGCGAAAAAGATTCGA
GAGCAACAAATACCTGGCTACGAAAACATCAAGGCTCCAGCTGATGATGCCGACCGGTCACTCGCCAATATCTTC
GGAATTGCGCTTACACGCCCGTGGATTATTCTCTTCGACCCGATATCCTTCTTCTGCGCCATTTATCTCTCGGTT
ATTTACACGCTTCTGTATATGCTTTTCGAGATTTACCCTATCGTGTTCCACCTTAAGCGTGGGTGGAACGCAGGC
GTCGCCGAATTGCCCTTACTTGGAACCATTGTCGGCGTTGTCATCGGTGGAGGTCTAATCGTACTGGATACGAGG
AAGCGTGCCAACAAGATCAAGCGAGGAGAAAGGACGCTACAAGATTTCGAGCCAGAAGAGCGCCTGGATCTAGCC
ATGGTTGGTGGTATCGGCTTTGCCATCGCCATGTTCTGGTTTGCTTGGACTGGGGAGTACAAGTACGTGCCCGAA
GAATCTGCCCCTGATCCTGAGAACGATACCGTATGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail