Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9508
Gene name
LocationContig_698:6361..7617
Strand-
Gene length (bp)1256
Transcript length (bp)1050
Coding sequence length (bp)1050
Protein length (aa) 350

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 1.1E-11 7 153

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6RVV4|TIC32_PEA Short-chain dehydrogenase TIC 32, chloroplastic OS=Pisum sativum GN=TIC32 PE=1 SV=1 1 334 1.0E-17
sp|A2RVM0|TIC32_ARATH Short-chain dehydrogenase TIC 32, chloroplastic OS=Arabidopsis thaliana GN=TIC32 PE=2 SV=1 4 284 2.0E-16
sp|Q9VLU5|WWOX_DROME WW domain-containing oxidoreductase OS=Drosophila melanogaster GN=Wwox PE=2 SV=1 5 330 3.0E-14
sp|Q91WL8|WWOX_MOUSE WW domain-containing oxidoreductase OS=Mus musculus GN=Wwox PE=1 SV=1 4 330 1.0E-12
sp|Q5R9W5|WWOX_PONAB WW domain-containing oxidoreductase OS=Pongo abelii GN=WWOX PE=2 SV=1 4 329 4.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6RVV4|TIC32_PEA Short-chain dehydrogenase TIC 32, chloroplastic OS=Pisum sativum GN=TIC32 PE=1 SV=1 1 334 1.0E-17
sp|A2RVM0|TIC32_ARATH Short-chain dehydrogenase TIC 32, chloroplastic OS=Arabidopsis thaliana GN=TIC32 PE=2 SV=1 4 284 2.0E-16
sp|Q9VLU5|WWOX_DROME WW domain-containing oxidoreductase OS=Drosophila melanogaster GN=Wwox PE=2 SV=1 5 330 3.0E-14
sp|Q91WL8|WWOX_MOUSE WW domain-containing oxidoreductase OS=Mus musculus GN=Wwox PE=1 SV=1 4 330 1.0E-12
sp|Q5R9W5|WWOX_PONAB WW domain-containing oxidoreductase OS=Pongo abelii GN=WWOX PE=2 SV=1 4 329 4.0E-11
sp|Q9ERI6|RDH14_MOUSE Retinol dehydrogenase 14 OS=Mus musculus GN=Rdh14 PE=1 SV=1 5 338 4.0E-11
sp|Q9NZC7|WWOX_HUMAN WW domain-containing oxidoreductase OS=Homo sapiens GN=WWOX PE=1 SV=1 4 329 7.0E-11
sp|Q8W3D9|PORB_ORYSJ Protochlorophyllide reductase B, chloroplastic OS=Oryza sativa subsp. japonica GN=PORB PE=2 SV=1 6 342 2.0E-10
sp|Q42850|PORB_HORVU Protochlorophyllide reductase B, chloroplastic OS=Hordeum vulgare GN=PORB PE=2 SV=1 6 338 7.0E-09
sp|Q9HBH5|RDH14_HUMAN Retinol dehydrogenase 14 OS=Homo sapiens GN=RDH14 PE=1 SV=1 5 329 2.0E-08
sp|Q42536|PORA_ARATH Protochlorophyllide reductase A, chloroplastic OS=Arabidopsis thaliana GN=PORA PE=1 SV=2 6 338 3.0E-08
sp|Q5F389|WWOX_CHICK WW domain-containing oxidoreductase OS=Gallus gallus GN=WWOX PE=2 SV=2 4 243 5.0E-08
sp|Q7XKF3|PORA_ORYSJ Protochlorophyllide reductase A, chloroplastic OS=Oryza sativa subsp. japonica GN=PORA PE=2 SV=1 63 338 6.0E-08
sp|P13653|PORA_HORVU Protochlorophyllide reductase A, chloroplastic OS=Hordeum vulgare GN=PORA PE=1 SV=1 63 338 3.0E-07
sp|Q803A8|WWOX_DANRE WW domain-containing oxidoreductase OS=Danio rerio GN=wwox PE=2 SV=1 4 258 4.0E-07
sp|Q9SDT1|POR_DAUCA Protochlorophyllide reductase, chloroplastic OS=Daucus carota GN=POR1 PE=2 SV=1 6 338 2.0E-06
sp|Q41578|PORA_WHEAT Protochlorophyllide reductase A, chloroplastic OS=Triticum aestivum GN=PORA PE=3 SV=1 63 338 2.0E-06
sp|O48741|PORC_ARATH Protochlorophyllide reductase C, chloroplastic OS=Arabidopsis thaliana GN=PORC PE=1 SV=1 6 338 3.0E-06
sp|Q01289|POR_PEA Protochlorophyllide reductase, chloroplastic OS=Pisum sativum GN=3PCR PE=1 SV=1 6 338 4.0E-06
sp|P21218|PORB_ARATH Protochlorophyllide reductase B, chloroplastic OS=Arabidopsis thaliana GN=PORB PE=1 SV=3 6 338 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 253 275 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9508
MPSSGGTILVTGANGGLGSAIVAHILKEPHLASDYTAVYTVRNEQAASRLRSVLAKAPAAHKHEMLELELGSVES
VKRTAAEVNRRVAAGELPPIRALILNAGYQDATAMTISDDGLEMSWQVNFLANLVLSLQLLQSMRKDDGRILLMG
SWAHDIEDERNAMGGSNHLYKPPQFETLFPGPEALAKGRWSTPQDDPSWYGGHRRYGASKLCTVMLMHELANRLA
KDPELSNIAVIGLDPGGMGSDISRRGSFMMSVVTMKVVLPLLAAILVRFYPNGAIRPLWKSASDVVGACFEVETP
KGKFLYLNGSEEWETAKDAQDEDKRRALWQYGLEAAGIKAGDTVLADWQ*
Coding >Hirsu2|9508
ATGCCATCCTCCGGGGGCACGATCCTCGTCACCGGTGCCAACGGCGGGCTCGGCTCCGCCATCGTGGCCCACATC
CTCAAGGAGCCGCACCTGGCGTCCGATTACACGGCCGTGTACACCGTCCGCAACGAGCAGGCCGCGTCCCGGCTG
CGTTCCGTCCTCGCCAAGGCCCCGGCCGCCCACAAGCATGAGATGCTGGAGCTGGAGCTGGGCTCGGTGGAGAGC
GTCAAGAGGACGGCGGCCGAGGTCAACCGCCGCGTCGCCGCCGGAGAGCTCCCTCCCATCAGGGCGCTCATCCTC
AACGCCGGATACCAAGACGCCACTGCCATGACCATTAGCGACGATGGCCTCGAGATGTCGTGGCAGGTCAATTTC
CTCGCCAACCTCGTCCTCTCTCTCCAGCTGCTCCAGAGCATGCGCAAGGACGACGGCCGGATCCTGCTCATGGGC
AGCTGGGCGCATGACATCGAGGATGAGCGCAACGCCATGGGAGGGAGCAACCACCTGTACAAGCCTCCTCAGTTC
GAGACTCTGTTTCCCGGCCCCGAGGCGCTGGCCAAGGGTCGGTGGAGCACGCCCCAGGATGATCCGTCGTGGTAT
GGCGGCCACCGCCGGTACGGGGCCAGCAAGCTGTGCACCGTGATGCTCATGCACGAGCTCGCCAACCGCTTGGCC
AAGGACCCCGAGCTCTCCAACATTGCCGTCATCGGCCTGGACCCGGGCGGCATGGGGTCCGACATCTCGAGACGA
GGCTCCTTCATGATGAGCGTCGTGACGATGAAGGTGGTGCTGCCGCTGCTGGCGGCCATCCTGGTCCGGTTTTAT
CCGAACGGGGCCATCCGGCCCCTGTGGAAGAGCGCGTCCGACGTCGTCGGCGCATGCTTCGAGGTGGAAACGCCA
AAGGGCAAGTTTCTGTATCTGAACGGGTCCGAGGAGTGGGAGACGGCCAAGGACGCGCAGGACGAGGACAAGAGA
AGGGCGCTGTGGCAATACGGGCTGGAGGCCGCCGGTATCAAGGCCGGCGACACTGTTTTGGCGGATTGGCAGTGA
Transcript >Hirsu2|9508
ATGCCATCCTCCGGGGGCACGATCCTCGTCACCGGTGCCAACGGCGGGCTCGGCTCCGCCATCGTGGCCCACATC
CTCAAGGAGCCGCACCTGGCGTCCGATTACACGGCCGTGTACACCGTCCGCAACGAGCAGGCCGCGTCCCGGCTG
CGTTCCGTCCTCGCCAAGGCCCCGGCCGCCCACAAGCATGAGATGCTGGAGCTGGAGCTGGGCTCGGTGGAGAGC
GTCAAGAGGACGGCGGCCGAGGTCAACCGCCGCGTCGCCGCCGGAGAGCTCCCTCCCATCAGGGCGCTCATCCTC
AACGCCGGATACCAAGACGCCACTGCCATGACCATTAGCGACGATGGCCTCGAGATGTCGTGGCAGGTCAATTTC
CTCGCCAACCTCGTCCTCTCTCTCCAGCTGCTCCAGAGCATGCGCAAGGACGACGGCCGGATCCTGCTCATGGGC
AGCTGGGCGCATGACATCGAGGATGAGCGCAACGCCATGGGAGGGAGCAACCACCTGTACAAGCCTCCTCAGTTC
GAGACTCTGTTTCCCGGCCCCGAGGCGCTGGCCAAGGGTCGGTGGAGCACGCCCCAGGATGATCCGTCGTGGTAT
GGCGGCCACCGCCGGTACGGGGCCAGCAAGCTGTGCACCGTGATGCTCATGCACGAGCTCGCCAACCGCTTGGCC
AAGGACCCCGAGCTCTCCAACATTGCCGTCATCGGCCTGGACCCGGGCGGCATGGGGTCCGACATCTCGAGACGA
GGCTCCTTCATGATGAGCGTCGTGACGATGAAGGTGGTGCTGCCGCTGCTGGCGGCCATCCTGGTCCGGTTTTAT
CCGAACGGGGCCATCCGGCCCCTGTGGAAGAGCGCGTCCGACGTCGTCGGCGCATGCTTCGAGGTGGAAACGCCA
AAGGGCAAGTTTCTGTATCTGAACGGGTCCGAGGAGTGGGAGACGGCCAAGGACGCGCAGGACGAGGACAAGAGA
AGGGCGCTGTGGCAATACGGGCTGGAGGCCGCCGGTATCAAGGCCGGCGACACTGTTTTGGCGGATTGGCAGTGA
Gene >Hirsu2|9508
ATGCCATCCTCCGGGGGCACGATCCTCGTCACCGGTGCCAACGGCGGGCTCGGCTCCGCCATCGTGGCCCACATC
CTCAAGGAGCCGCACCTGGCGTCCGATTACACGGCCGTGTACACCGTCCGCAACGAGCAGGCCGCGTCCCGGCTG
CGTTCCGTCCTCGCCAAGGCCCCGGCCGCCCACAAGCATGAGATGCTGGAGCTGGAGCTGGGCTCGGTGGAGAGC
GTCAAGAGGACGGCGGCCGAGGTCAACCGCCGCGTCGCCGCCGGAGAGCTCCCTCCCATCAGGGCGCTCATCCTC
AACGCCGGATACCAAGACGCCACTGCCATGGTGGGTGTGAACAGGAGCCGTCCCGCCAGCGAATGTGCATGAGTG
CTCGAGTAGCCTCGTCTGACAGCCAACCATGTTGCAAGACCATTAGCGACGATGGCCTCGAGATGTCGTGGCAGG
TCAATTTCCTCGCCAACCTCGTCCTCTCTCTCCAGCTGCTCCAGAGCATGCGCAAGGACGACGGCCGGATCCTGC
TCATGGGCAGCTGGGCGCATGAGTGGGTGCTTCACGGCGACCGTCTGGAAACCGCGGCCGAGCCAATGCTGACGA
GGCGTGAAGCATCGAGGATGAGCGCAACGCCATGGGAGGGAGCAACCACCTGTACAAGCCTCCTCAGTTCGAGAC
TCTGTTTCCCGGCCCCGAGGCGCTGGCCAAGGGTCGGTGGAGCACGCCCCAGGATGATCCGTCGTGGTATGGCGG
CCACCGCCGGTACGGGGCCAGCAAGCTGTGCACCGTGATGCTCATGTCAGTGTCCGTCGGGAGGGCCGCGTGCGA
CGGGAGACGGAGGCTGACGGCAAGGATGCAGGCACGAGCTCGCCAACCGCTTGGCCAAGGACCCCGAGCTCTCCA
ACATTGCCGTCATCGGCCTGGACCCGGGCGGCATGGGGTCCGACATCTCGAGACGAGGCTCCTTCATGATGAGCG
TCGTGACGATGAAGGTGGTGCTGCCGCTGCTGGCGGCCATCCTGGTCCGGTTTTATCCGAACGGGGCCATCCGGC
CCCTGTGGAAGAGCGCGTCCGACGTCGTCGGCGCATGCTTCGAGGTGGAAACGCCAAAGGGCAAGTTTCTGTATC
TGAACGGGTCCGAGGAGTGGGAGACGGCCAAGGACGCGCAGGACGAGGACAAGAGAAGGGCGCTGTGGCAATACG
GGCTGGAGGCCGCCGGTATCAAGGCCGGCGACACTGTTTTGGCGGATTGGCAGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail