Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9492
Gene name
LocationContig_696:2479..3471
Strand-
Gene length (bp)992
Transcript length (bp)867
Coding sequence length (bp)867
Protein length (aa) 289

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01284 MARVEL Membrane-associating domain 3.3E-09 22 113

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.5

Transmembrane Domains

Domain # Start End Length
1 21 43 22
2 53 70 17
3 83 105 22
4 150 172 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9492
MEQAQQHSGADGHVLRTPAWMLAIRIVQLLLSIIVLALAGSIAHDVYLDEVGLALAISIITWLIVAYVVITEKMA
ACRVAYHIIAVLVLDGLLVVLWLATFAAVAARRAQFVFDVTVDGCYSNGGLFNSKSCSLTKRAVILFKRGGDMMS
SIAGLGALLWILFIVTFVWSLVQFLRGRKQGRFPLGAGPTAAGPTETKLKQQQPQQPPAPGPYQQQPPYSPPPQG
GGAYAPPQQGQQQPPYGQYAPQPYEPPPPHYPQQYQQPHGSELSAQHTPVSPPFAHSPSPPGH*
Coding >Hirsu2|9492
ATGGAGCAGGCCCAGCAGCACTCGGGAGCCGATGGGCACGTCCTACGGACGCCGGCCTGGATGCTGGCCATTCGC
ATCGTGCAGTTGCTGCTGTCCATCATTGTCCTCGCTCTCGCCGGCTCCATCGCGCACGATGTCTATCTCGATGAG
GTCGGCCTCGCCCTGGCCATATCCATCATCACCTGGCTCATCGTCGCGTACGTGGTCATCACGGAGAAGATGGCG
GCCTGCCGCGTGGCCTACCACATCATCGCCGTCCTGGTCCTGGACGGGCTGCTCGTCGTGCTCTGGCTGGCCACA
TTCGCGGCCGTGGCTGCGCGCCGGGCCCAGTTCGTCTTCGACGTCACGGTCGACGGCTGCTACAGCAACGGCGGC
CTGTTCAACAGCAAGAGCTGCTCCCTGACCAAGAGGGCCGTCATCCTGTTCAAGAGGGGCGGCGACATGATGTCG
TCCATCGCCGGCCTGGGCGCCCTGCTTTGGATCCTGTTCATCGTCACCTTCGTCTGGTCTCTCGTCCAGTTCCTT
CGCGGGCGCAAGCAAGGCCGCTTCCCGCTCGGCGCCGGCCCGACGGCCGCCGGCCCGACGGAGACCAAGCTCAAG
CAGCAGCAGCCACAGCAGCCGCCGGCGCCGGGCCCGTACCAGCAACAGCCTCCGTACTCGCCCCCTCCCCAGGGC
GGAGGCGCCTACGCGCCGCCCCAGCAGGGCCAGCAGCAGCCGCCGTACGGCCAGTACGCGCCCCAGCCGTACGAA
CCGCCGCCGCCGCACTATCCGCAGCAGTACCAGCAACCTCATGGCAGCGAGCTGTCGGCGCAGCATACGCCCGTC
TCGCCTCCCTTCGCCCACTCCCCCTCGCCGCCGGGCCACTAG
Transcript >Hirsu2|9492
ATGGAGCAGGCCCAGCAGCACTCGGGAGCCGATGGGCACGTCCTACGGACGCCGGCCTGGATGCTGGCCATTCGC
ATCGTGCAGTTGCTGCTGTCCATCATTGTCCTCGCTCTCGCCGGCTCCATCGCGCACGATGTCTATCTCGATGAG
GTCGGCCTCGCCCTGGCCATATCCATCATCACCTGGCTCATCGTCGCGTACGTGGTCATCACGGAGAAGATGGCG
GCCTGCCGCGTGGCCTACCACATCATCGCCGTCCTGGTCCTGGACGGGCTGCTCGTCGTGCTCTGGCTGGCCACA
TTCGCGGCCGTGGCTGCGCGCCGGGCCCAGTTCGTCTTCGACGTCACGGTCGACGGCTGCTACAGCAACGGCGGC
CTGTTCAACAGCAAGAGCTGCTCCCTGACCAAGAGGGCCGTCATCCTGTTCAAGAGGGGCGGCGACATGATGTCG
TCCATCGCCGGCCTGGGCGCCCTGCTTTGGATCCTGTTCATCGTCACCTTCGTCTGGTCTCTCGTCCAGTTCCTT
CGCGGGCGCAAGCAAGGCCGCTTCCCGCTCGGCGCCGGCCCGACGGCCGCCGGCCCGACGGAGACCAAGCTCAAG
CAGCAGCAGCCACAGCAGCCGCCGGCGCCGGGCCCGTACCAGCAACAGCCTCCGTACTCGCCCCCTCCCCAGGGC
GGAGGCGCCTACGCGCCGCCCCAGCAGGGCCAGCAGCAGCCGCCGTACGGCCAGTACGCGCCCCAGCCGTACGAA
CCGCCGCCGCCGCACTATCCGCAGCAGTACCAGCAACCTCATGGCAGCGAGCTGTCGGCGCAGCATACGCCCGTC
TCGCCTCCCTTCGCCCACTCCCCCTCGCCGCCGGGCCACTAG
Gene >Hirsu2|9492
ATGGAGCAGGCCCAGCAGCACTCGGGAGCCGATGGGCACGTCCTACGGACGCCGGCCTGGATGCTGGCCATTCGC
ATCGTGCAGTTGCTGCTGTCCATCATTGTCCTCGCTCTCGCCGGCTCCATCGCGCACGATGTCTATCTCGATGAG
GTCGGCCTCGCCCTGGCCATAGTGCGTCCTCTCGTCTCCTCCCCTCCCCTTTTCCGAGGCTGACGCGCCAATGTC
CAGTCCATCATCACCTGGCTCATCGTCGCGTACGTGGTCATCACGGAGAAGATGGCGGCCTGCCGCGTGGCCTAC
CACATCATCGCCGTCCTGGTCCTGGACGGGCTGCTCGTCGTGCTCTGGCTGGCCACATTCGCGGCCGTGGCTGCG
CGCCGGGCCCAGTTCGTCTTCGACGTCACGGTCGACGGCTGCTACAGCAACGGCGGCCTGTTCAACAGCAAGAGC
TGCTCCCTGACCAAGAGGGCCGTCATCCTGTTCAAGAGGGGCGGCGACATGATGTCGTCCATCGCCGGCCTGGGC
GCCCTGCTTTGGTACGTTTTGAGCTGCACAGCAGCATCTACACACCATTGCTTCTGCACCCACTGACCGCTGCCG
GCAGGATCCTGTTCATCGTCACCTTCGTCTGGTCTCTCGTCCAGTTCCTTCGCGGGCGCAAGCAAGGCCGCTTCC
CGCTCGGCGCCGGCCCGACGGCCGCCGGCCCGACGGAGACCAAGCTCAAGCAGCAGCAGCCACAGCAGCCGCCGG
CGCCGGGCCCGTACCAGCAACAGCCTCCGTACTCGCCCCCTCCCCAGGGCGGAGGCGCCTACGCGCCGCCCCAGC
AGGGCCAGCAGCAGCCGCCGTACGGCCAGTACGCGCCCCAGCCGTACGAACCGCCGCCGCCGCACTATCCGCAGC
AGTACCAGCAACCTCATGGCAGCGAGCTGTCGGCGCAGCATACGCCCGTCTCGCCTCCCTTCGCCCACTCCCCCT
CGCCGCCGGGCCACTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail