Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9489
Gene name
LocationContig_695:9110..10080
Strand-
Gene length (bp)970
Transcript length (bp)756
Coding sequence length (bp)756
Protein length (aa) 252

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09769 ApoO Apolipoprotein O 2.2E-40 76 201

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P50087|MIC26_YEAST MICOS subunit MIC26 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIC26 PE=1 SV=1 107 192 2.0E-12

GO

GO Term Description Terminal node
GO:0061617 MICOS complex Yes
GO:0042407 cristae formation Yes
GO:0044446 intracellular organelle part No
GO:0009987 cellular process No
GO:0032991 protein-containing complex No
GO:0044424 intracellular part No
GO:0016043 cellular component organization No
GO:0071840 cellular component organization or biogenesis No
GO:0098796 membrane protein complex No
GO:0006996 organelle organization No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:0044425 membrane part No
GO:0044455 mitochondrial membrane part No
GO:0061024 membrane organization No
GO:0098800 inner mitochondrial membrane protein complex No
GO:0007005 mitochondrion organization No
GO:0007007 inner mitochondrial membrane organization No
GO:0008150 biological_process No
GO:0044429 mitochondrial part No
GO:0007006 mitochondrial membrane organization No
GO:0044422 organelle part No
GO:0098798 mitochondrial protein complex No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.5

Transmembrane Domains

Domain # Start End Length
1 12 34 22
2 140 157 17
3 164 186 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9489
MAARVLLQRRSVAPLAALALGGVALAPATVLAEAPTEKRKPIYDDINVPSPNRHPPAVSQLKPTPSPQPAEDEAA
ARPRGPTPTDRLAVQIGRARMLLYRCAATAEDKVNGAMDSAFHLEQSFTSTVASLAPPRESGEKLMPGAIYVLVA
AMAGSIVARNRNVLLRAAVPLALGFGAGWLVLPLTMRNVADLAWQYEQRAPALAEAHLKLRDGIQRSISFARVHG
ELGVRYVDEKVTDARETVEGWVKQGK*
Coding >Hirsu2|9489
ATGGCTGCAAGAGTGCTGCTGCAACGGCGTTCCGTCGCGCCGTTGGCCGCCCTCGCCCTCGGCGGCGTGGCTCTG
GCCCCGGCCACGGTCCTGGCCGAGGCGCCGACGGAAAAGAGGAAGCCGATCTACGACGACATCAACGTGCCGTCG
CCGAACCGCCACCCGCCGGCCGTGTCCCAGCTGAAGCCGACGCCGTCGCCGCAGCCCGCCGAGGACGAGGCCGCG
GCCCGGCCACGGGGCCCCACGCCGACGGACCGGCTGGCGGTGCAGATCGGCCGGGCCCGCATGCTCCTGTACCGG
TGCGCGGCGACGGCCGAGGACAAGGTCAACGGCGCGATGGACTCGGCCTTCCATCTCGAGCAGTCCTTCACCAGC
ACGGTGGCCTCGCTGGCCCCGCCGCGCGAGAGCGGCGAGAAGCTCATGCCCGGCGCCATCTACGTCCTCGTCGCC
GCCATGGCCGGCAGCATCGTCGCCCGCAACCGCAACGTCCTGCTGCGGGCCGCCGTGCCCCTCGCCCTCGGCTTC
GGCGCCGGCTGGCTCGTCCTGCCCCTGACCATGCGCAACGTCGCCGACCTGGCCTGGCAGTACGAGCAGCGCGCC
CCCGCCCTGGCCGAGGCCCACCTCAAGCTGCGCGACGGCATTCAGCGCAGCATCAGCTTCGCCAGGGTCCACGGC
GAGCTCGGTGTACGATACGTCGACGAAAAGGTCACCGACGCTCGCGAGACCGTCGAGGGCTGGGTGAAACAGGGC
AAATAG
Transcript >Hirsu2|9489
ATGGCTGCAAGAGTGCTGCTGCAACGGCGTTCCGTCGCGCCGTTGGCCGCCCTCGCCCTCGGCGGCGTGGCTCTG
GCCCCGGCCACGGTCCTGGCCGAGGCGCCGACGGAAAAGAGGAAGCCGATCTACGACGACATCAACGTGCCGTCG
CCGAACCGCCACCCGCCGGCCGTGTCCCAGCTGAAGCCGACGCCGTCGCCGCAGCCCGCCGAGGACGAGGCCGCG
GCCCGGCCACGGGGCCCCACGCCGACGGACCGGCTGGCGGTGCAGATCGGCCGGGCCCGCATGCTCCTGTACCGG
TGCGCGGCGACGGCCGAGGACAAGGTCAACGGCGCGATGGACTCGGCCTTCCATCTCGAGCAGTCCTTCACCAGC
ACGGTGGCCTCGCTGGCCCCGCCGCGCGAGAGCGGCGAGAAGCTCATGCCCGGCGCCATCTACGTCCTCGTCGCC
GCCATGGCCGGCAGCATCGTCGCCCGCAACCGCAACGTCCTGCTGCGGGCCGCCGTGCCCCTCGCCCTCGGCTTC
GGCGCCGGCTGGCTCGTCCTGCCCCTGACCATGCGCAACGTCGCCGACCTGGCCTGGCAGTACGAGCAGCGCGCC
CCCGCCCTGGCCGAGGCCCACCTCAAGCTGCGCGACGGCATTCAGCGCAGCATCAGCTTCGCCAGGGTCCACGGC
GAGCTCGGTGTACGATACGTCGACGAAAAGGTCACCGACGCTCGCGAGACCGTCGAGGGCTGGGTGAAACAGGGC
AAATAG
Gene >Hirsu2|9489
ATGGCTGCAAGAGTGCTGCTGCAACGGGTAAGGCTCCTGCCCGTCTCCCCCGGGAGCCGTCCACGCCCGGTAGAG
AGCGCCTCGGAGAAGGGCTAACGAAACGGGCTCGGCTCGCCGCTCTTGCCAAACAGCGTTCCGTCGCGCCGTTGG
CCGCCCTCGCCCTCGGCGGCGTGGCTCTGGCCCCGGCCACGGTCCTGGCCGAGGCGCCGACGGAAAAGGTGCGCC
GCCCTCGCCCTACTCCCCGAAAACAAGCCCGAAAAGGCCGTGCTCCCATCGTCCGCCCCCGGCTGACGGCGCGGG
AAACGCCAAAAAAAAAAAACAAAAACAGAGGAAGCCGATCTACGACGACATCAACGTGCCGTCGCCGAACCGCCA
CCCGCCGGCCGTGTCCCAGCTGAAGCCGACGCCGTCGCCGCAGCCCGCCGAGGACGAGGCCGCGGCCCGGCCACG
GGGCCCCACGCCGACGGACCGGCTGGCGGTGCAGATCGGCCGGGCCCGCATGCTCCTGTACCGGTGCGCGGCGAC
GGCCGAGGACAAGGTCAACGGCGCGATGGACTCGGCCTTCCATCTCGAGCAGTCCTTCACCAGCACGGTGGCCTC
GCTGGCCCCGCCGCGCGAGAGCGGCGAGAAGCTCATGCCCGGCGCCATCTACGTCCTCGTCGCCGCCATGGCCGG
CAGCATCGTCGCCCGCAACCGCAACGTCCTGCTGCGGGCCGCCGTGCCCCTCGCCCTCGGCTTCGGCGCCGGCTG
GCTCGTCCTGCCCCTGACCATGCGCAACGTCGCCGACCTGGCCTGGCAGTACGAGCAGCGCGCCCCCGCCCTGGC
CGAGGCCCACCTCAAGCTGCGCGACGGCATTCAGCGCAGCATCAGCTTCGCCAGGGTCCACGGCGAGCTCGGTGT
ACGATACGTCGACGAAAAGGTCACCGACGCTCGCGAGACCGTCGAGGGCTGGGTGAAACAGGGCAAATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail