Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9483
Gene name
LocationContig_694:7325..8009
Strand+
Gene length (bp)684
Transcript length (bp)471
Coding sequence length (bp)471
Protein length (aa) 157

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01627 Hpt Hpt domain 6.4E-12 49 124

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94321|MPR1_SCHPO Multistep phosphorelay regulator 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mpr1 PE=1 SV=1 22 147 2.0E-32
sp|Q59WC6|YPD1_CANAL Phosphorelay intermediate protein YPD1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YPD1 PE=3 SV=1 10 108 6.0E-20
sp|Q07688|YPD1_YEAST Phosphorelay intermediate protein YPD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPD1 PE=1 SV=1 17 104 1.0E-13

GO

GO Term Description Terminal node
GO:0000160 phosphorelay signal transduction system Yes
GO:0007165 signal transduction No
GO:0009987 cellular process No
GO:0050789 regulation of biological process No
GO:0008150 biological_process No
GO:0065007 biological regulation No
GO:0035556 intracellular signal transduction No
GO:0050794 regulation of cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9483
MAPADDKSASEDGLDLIPNDAVDMNTFSQILEMDEPEDHEFSHSIVFGFFDQAEETFGSMDTALGEKNLKKLADL
SHFLKGSSATLGLVKVRAGCEKIERYGKKENVDGSAELDSELCLERIAEALKVVKTDYEDAERALRKYYEKSEKK
QSDEAA*
Coding >Hirsu2|9483
ATGGCGCCGGCCGACGACAAGAGCGCGTCCGAGGATGGGCTTGACCTCATACCCAACGACGCCGTCGACATGAAC
ACATTCAGCCAAATCCTCGAGATGGACGAGCCCGAGGACCACGAATTTAGCCACTCCATTGTCTTCGGTTTTTTC
GACCAGGCCGAGGAGACGTTCGGCTCCATGGACACGGCCCTCGGAGAGAAGAATCTTAAGAAGTTGGCCGATCTC
AGCCACTTCCTCAAGGGCTCGTCCGCGACGCTCGGCTTGGTCAAGGTCAGAGCCGGATGTGAGAAGATAGAGCGT
TACGGCAAGAAGGAGAACGTCGACGGCTCCGCCGAGCTCGATTCGGAGCTCTGCTTGGAGCGCATCGCCGAGGCT
CTCAAGGTTGTCAAGACCGATTACGAAGATGCCGAGCGCGCCCTCCGAAAGTACTACGAGAAGAGCGAAAAGAAG
CAAAGTGACGAAGCCGCATAG
Transcript >Hirsu2|9483
ATGGCGCCGGCCGACGACAAGAGCGCGTCCGAGGATGGGCTTGACCTCATACCCAACGACGCCGTCGACATGAAC
ACATTCAGCCAAATCCTCGAGATGGACGAGCCCGAGGACCACGAATTTAGCCACTCCATTGTCTTCGGTTTTTTC
GACCAGGCCGAGGAGACGTTCGGCTCCATGGACACGGCCCTCGGAGAGAAGAATCTTAAGAAGTTGGCCGATCTC
AGCCACTTCCTCAAGGGCTCGTCCGCGACGCTCGGCTTGGTCAAGGTCAGAGCCGGATGTGAGAAGATAGAGCGT
TACGGCAAGAAGGAGAACGTCGACGGCTCCGCCGAGCTCGATTCGGAGCTCTGCTTGGAGCGCATCGCCGAGGCT
CTCAAGGTTGTCAAGACCGATTACGAAGATGCCGAGCGCGCCCTCCGAAAGTACTACGAGAAGAGCGAAAAGAAG
CAAAGTGACGAAGCCGCATAG
Gene >Hirsu2|9483
ATGGCGCCGGCCGACGACAAGGTAGGCCGCCGGCGCTCGACGTCGGGCCCTCGCATTTGCCTGCCATGGTCCTGC
ACGCTAACCCGCCTCCGTTACAGAGCGCGTCCGAGGATGGGCTTGACCTCATACCCAACGACGCCGTCGACATGA
ACACATTCAGCCAAATCCTCGAGATGGACGAGCCCGAGGACCACGAATTTAGCCACTCCATTGTCTTCGGTTTTT
TCGACCAGGCCGAGGAGACGTTCGGCTCCATGGACACGGCCCTGTAAGTCGCGCCTCTCCTCGGCCACCGCCCTT
GGCACAACTGCCAGAACGCCTGTCTCGAATCAAGTCTGTGTGCTTCGGGCTCGAATCCTGCTGACTGGCTCCTCC
TTACCTGTTGTCCCCCTGTGCCTGGGCAGCGGAGAGAAGAATCTTAAGAAGTTGGCCGATCTCAGCCACTTCCTC
AAGGGCTCGTCCGCGACGCTCGGCTTGGTCAAGGTCAGAGCCGGATGTGAGAAGATAGAGCGTTACGGCAAGAAG
GAGAACGTCGACGGCTCCGCCGAGCTCGATTCGGAGCTCTGCTTGGAGCGCATCGCCGAGGCTCTCAAGGTTGTC
AAGACCGATTACGAAGATGCCGAGCGCGCCCTCCGAAAGTACTACGAGAAGAGCGAAAAGAAGCAAAGTGACGAA
GCCGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail