Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9479
Gene name
LocationContig_693:7308..8801
Strand+
Gene length (bp)1493
Transcript length (bp)1374
Coding sequence length (bp)1374
Protein length (aa) 458

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01494 FAD_binding_3 FAD binding domain 1.5E-08 318 376
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.4E-04 5 62

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q53552|NHG2_PSEPU Salicylate hydroxylase OS=Pseudomonas putida GN=nahG PE=4 SV=1 1 393 9.0E-12
sp|Q0JCU7|ZEP_ORYSJ Zeaxanthin epoxidase, chloroplastic OS=Oryza sativa subsp. japonica GN=ZEP PE=2 SV=1 3 396 1.0E-08
sp|Q40412|ABA2_NICPL Zeaxanthin epoxidase, chloroplastic OS=Nicotiana plumbaginifolia GN=ABA2 PE=1 SV=1 1 365 1.0E-07
sp|O81360|ABA2_PRUAR Zeaxanthin epoxidase, chloroplastic OS=Prunus armeniaca PE=2 SV=1 1 383 2.0E-07
sp|Q88FY2|6HN3M_PSEPK 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas putida (strain KT2440) GN=nicC PE=1 SV=1 54 384 2.0E-07

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0043168 anion binding No
GO:0000166 nucleotide binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.5038 0.4304 0.1221 0.0246 0.1347 0.0553 0.572 0.1417 0.3945 0.0082

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4536
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4000
Ophiocordyceps australis map64 (Brazil) OphauB2|7464
Ophiocordyceps camponoti-floridani Ophcf2|06248
Ophiocordyceps camponoti-rufipedis Ophun1|5935
Ophiocordyceps kimflemingae Ophio5|3266
Ophiocordyceps subramaniannii Hirsu2|9479 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9479
MEIVILGAGISGCSAYLLLKKHLPKPLSAEPHSITIFEAHDSEAGARSRSTLVVGGGLGVGANGLNVLKRLDEDL
LLDVVRGGYVVPTMKMKAKGGALLARTQPGGGGEAGADMHMVASSRHALWTCLRARIPDGAIVTKTVARVVARPE
GRNLVVFADGSPPVEADLVIGADGVKSVAKHALFPEADQDPFPPQYEGLVGVGGFVPSALVRDRVEKGSMNFVFG
GNGFFGYFFANSAPSSPHRESPFHLSEPGDTLAWWSTFTADECPTASTLDADAVTRQLQGRHKDWKDPVVQAILP
SLRVENMYPTWTVPPLPTWERDGVVLIGDAAHALPPTSGQGSSQALEDAEAFTLFLSHHLRRAYQEHRTDTASRK
RVVKTAAKQYMELRIPRVSKILHDAQKRQNSKRDMSVLEEYLMYLYLWIMGCFPSLLSKPVNDVFRYNVAEEVKK
RLGKAET*
Coding >Hirsu2|9479
ATGGAAATCGTCATCCTCGGCGCGGGCATCTCCGGCTGCTCGGCCTATCTGCTGCTGAAGAAGCACCTGCCCAAG
CCTTTGTCAGCAGAACCCCACTCCATCACCATCTTCGAAGCCCACGACAGCGAGGCTGGCGCGCGCTCGAGGTCG
ACGCTGGTCGTCGGCGGCGGCCTGGGCGTCGGCGCCAACGGGCTCAACGTGCTGAAGCGCCTGGACGAGGACCTG
CTGCTCGACGTTGTGCGCGGCGGCTATGTCGTGCCGACGATGAAGATGAAGGCCAAGGGCGGCGCCCTCCTGGCC
CGCACCCAGCCCGGCGGCGGCGGAGAGGCCGGCGCCGACATGCACATGGTCGCCAGCAGCCGCCACGCGCTGTGG
ACGTGCCTGCGCGCGCGCATTCCCGACGGCGCCATCGTCACCAAGACGGTCGCCCGTGTCGTCGCCCGGCCCGAG
GGCCGCAACCTCGTCGTCTTCGCCGACGGGAGCCCGCCCGTCGAGGCGGACCTGGTCATCGGCGCCGACGGCGTC
AAGAGCGTCGCCAAGCACGCCCTGTTTCCCGAGGCCGACCAGGACCCGTTCCCGCCGCAATACGAGGGTCTCGTC
GGCGTCGGCGGCTTCGTCCCCTCCGCCCTCGTCCGGGACCGCGTGGAGAAGGGGTCGATGAACTTCGTCTTCGGC
GGCAACGGCTTCTTCGGCTACTTCTTCGCCAACAGCGCGCCCTCGTCGCCGCACCGCGAGTCCCCCTTCCACCTG
TCCGAGCCGGGCGACACCCTTGCCTGGTGGTCGACCTTTACGGCCGACGAGTGCCCGACGGCCAGCACGCTCGAC
GCCGACGCCGTCACGCGCCAGCTGCAGGGCCGCCACAAGGACTGGAAAGACCCGGTGGTGCAGGCCATCCTGCCC
TCGCTCCGCGTCGAAAACATGTATCCCACCTGGACGGTGCCGCCGCTGCCGACCTGGGAGCGCGACGGCGTCGTC
CTCATCGGCGACGCCGCCCACGCCCTGCCGCCCACGTCGGGCCAGGGGTCATCGCAGGCCCTGGAAGACGCCGAG
GCTTTCACGCTCTTCCTGAGCCACCATCTGCGCAGAGCCTACCAAGAGCACCGGACGGACACGGCCAGCCGCAAG
CGGGTTGTCAAGACGGCCGCGAAGCAGTACATGGAGCTGCGCATCCCCCGCGTCTCCAAGATCCTGCACGACGCG
CAGAAGAGGCAGAACTCGAAGCGGGACATGTCGGTCCTGGAGGAATACCTCATGTACTTGTACTTGTGGATAATG
GGTTGCTTTCCCAGCCTCTTGTCGAAGCCTGTGAACGACGTCTTTCGATACAATGTGGCCGAAGAGGTCAAGAAG
CGATTGGGCAAGGCAGAAACATGA
Transcript >Hirsu2|9479
ATGGAAATCGTCATCCTCGGCGCGGGCATCTCCGGCTGCTCGGCCTATCTGCTGCTGAAGAAGCACCTGCCCAAG
CCTTTGTCAGCAGAACCCCACTCCATCACCATCTTCGAAGCCCACGACAGCGAGGCTGGCGCGCGCTCGAGGTCG
ACGCTGGTCGTCGGCGGCGGCCTGGGCGTCGGCGCCAACGGGCTCAACGTGCTGAAGCGCCTGGACGAGGACCTG
CTGCTCGACGTTGTGCGCGGCGGCTATGTCGTGCCGACGATGAAGATGAAGGCCAAGGGCGGCGCCCTCCTGGCC
CGCACCCAGCCCGGCGGCGGCGGAGAGGCCGGCGCCGACATGCACATGGTCGCCAGCAGCCGCCACGCGCTGTGG
ACGTGCCTGCGCGCGCGCATTCCCGACGGCGCCATCGTCACCAAGACGGTCGCCCGTGTCGTCGCCCGGCCCGAG
GGCCGCAACCTCGTCGTCTTCGCCGACGGGAGCCCGCCCGTCGAGGCGGACCTGGTCATCGGCGCCGACGGCGTC
AAGAGCGTCGCCAAGCACGCCCTGTTTCCCGAGGCCGACCAGGACCCGTTCCCGCCGCAATACGAGGGTCTCGTC
GGCGTCGGCGGCTTCGTCCCCTCCGCCCTCGTCCGGGACCGCGTGGAGAAGGGGTCGATGAACTTCGTCTTCGGC
GGCAACGGCTTCTTCGGCTACTTCTTCGCCAACAGCGCGCCCTCGTCGCCGCACCGCGAGTCCCCCTTCCACCTG
TCCGAGCCGGGCGACACCCTTGCCTGGTGGTCGACCTTTACGGCCGACGAGTGCCCGACGGCCAGCACGCTCGAC
GCCGACGCCGTCACGCGCCAGCTGCAGGGCCGCCACAAGGACTGGAAAGACCCGGTGGTGCAGGCCATCCTGCCC
TCGCTCCGCGTCGAAAACATGTATCCCACCTGGACGGTGCCGCCGCTGCCGACCTGGGAGCGCGACGGCGTCGTC
CTCATCGGCGACGCCGCCCACGCCCTGCCGCCCACGTCGGGCCAGGGGTCATCGCAGGCCCTGGAAGACGCCGAG
GCTTTCACGCTCTTCCTGAGCCACCATCTGCGCAGAGCCTACCAAGAGCACCGGACGGACACGGCCAGCCGCAAG
CGGGTTGTCAAGACGGCCGCGAAGCAGTACATGGAGCTGCGCATCCCCCGCGTCTCCAAGATCCTGCACGACGCG
CAGAAGAGGCAGAACTCGAAGCGGGACATGTCGGTCCTGGAGGAATACCTCATGTACTTGTACTTGTGGATAATG
GGTTGCTTTCCCAGCCTCTTGTCGAAGCCTGTGAACGACGTCTTTCGATACAATGTGGCCGAAGAGGTCAAGAAG
CGATTGGGCAAGGCAGAAACATGA
Gene >Hirsu2|9479
ATGGAAATCGTCATCCTCGGCGCGGGCATCTCCGGCTGCTCGGCCTATCTGCTGCTGAAGAAGCACCTGCCCAAG
CCTTTGTCAGCAGAACCCCACTCCATCACCATCTTCGAAGCCCACGACAGCGAGGCTGGCGCGCGCTCGAGGTCG
ACGCTGGTCGTCGGCGGCGGCCTGGGCGTCGGCGCCAACGGGCTCAACGTGCTGAAGCGCCTGGACGAGGACCTG
CTGCTCGACGTTGTGCGCGGCGGCTATGTCGTGCCGACGATGAAGATGAAGGCCAAGGGCGGCGCCCTCCTGGCC
CGCACCCAGCCCGGCGGCGGCGGAGAGGCCGGCGCCGACATGCACATGGTCGCCAGCAGCCGCCACGCGCTGTGG
ACGTGCCTGCGCGCGCGCATTCCCGACGGCGCCATCGTCACCAAGACGGTCGCCCGTGTCGTCGCCCGGCCCGAG
GGCCGCAACCTCGTCGTCTTCGCCGACGGGAGCCCGCCCGTCGAGGCGGACCTGGTCATCGGCGCCGACGGCGTC
AAGAGCGTCGCCAAGCACGCCCTGTTTCCCGAGGCCGACCAGGACCCGTTCCCGCCGCAATACGAGTAGGCCCGA
CTTCATCTGCTTCGGCTGCTGACGCCCTGGGCTCTGGACTGACGCGCAAGCCGCAGGGGTCTCGTCGGCGTCGGC
GGCTTCGTCCCCTCCGCCCTCGTCCGGGACCGCGTGGAGAAGGGGTCGATGAACTTCGTCTTCGGCGGCAACGGC
TTCTTCGGCTACTTCTTCGCCAACAGCGCGCCCTCGTCGCCGCACCGCGAGTCCCCCTTCCACCTGTCCGAGCCG
GGCGACACCCTTGCCTGGTGGTCGACCTTTACGGCCGACGAGTGCCCGACGGCCAGCACGCTCGACGCCGACGCC
GTCACGCGCCAGCTGCAGGGCCGCCACAAGGACTGGAAAGACCCGGTGGTGCAGGCCATCCTGCCCTCGCTCCGC
GTCGAAAACATGTATCCCACCTGGACGGTGCCGCCGCTGCCGACCTGGGAGCGCGACGGCGTCGTCCTCATCGGC
GACGCCGCCCACGCCCTGCCGCCCACGTCGGGCCAGGGGTCATCGCAGGCCCTGGAAGACGCCGAGGCTTTCACG
CTCTTCCTGAGCCACCATCTGCGCAGAGCCTACCAAGAGCACCGGACGGACACGGCCAGCCGCAAGCGGGTTGTC
AAGACGGCCGCGAAGCAGTACATGGAGCTGCGCATCCCCCGCGTCTCCAAGATCCTGCACGACGCGCAGAAGAGG
CAGAACTCGAAGCGGGACATGTCGGTCCTGGAGGAATACCTCATGTACTTGTACTTGTGGATAATGGGTAAGCCC
TCCGTTTGTCCGTCTGTCAGCGGGACGAGAGCTTATCAGATCCAGGTTGCTTTCCCAGCCTCTTGTCGAAGCCTG
TGAACGACGTCTTTCGATACAATGTGGCCGAAGAGGTCAAGAAGCGATTGGGCAAGGCAGAAACATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail