Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9479
Gene name
LocationContig_693:7308..8801
Strand+
Gene length (bp)1493
Transcript length (bp)1374
Coding sequence length (bp)1374
Protein length (aa) 458

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01494 FAD_binding_3 FAD binding domain 1.4E-08 318 376
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.4E-04 5 62

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q53552|NHG2_PSEPU Salicylate hydroxylase OS=Pseudomonas putida GN=nahG PE=4 SV=1 1 393 9.0E-12
sp|Q0JCU7|ZEP_ORYSJ Zeaxanthin epoxidase, chloroplastic OS=Oryza sativa subsp. japonica GN=ZEP PE=2 SV=1 3 396 1.0E-08
sp|Q40412|ABA2_NICPL Zeaxanthin epoxidase, chloroplastic OS=Nicotiana plumbaginifolia GN=ABA2 PE=1 SV=1 1 365 1.0E-07
sp|O81360|ABA2_PRUAR Zeaxanthin epoxidase, chloroplastic OS=Prunus armeniaca PE=2 SV=1 1 383 2.0E-07
sp|Q88FY2|6HN3M_PSEPK 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas putida (strain KT2440) GN=nicC PE=1 SV=1 54 384 2.0E-07

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0050662 coenzyme binding No
GO:1901363 heterocyclic compound binding No
GO:0048037 cofactor binding No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:0003674 molecular_function No
GO:0043168 anion binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9479
MEIVILGAGISGCSAYLLLKKHLPKPLSAEPHSITIFEAHDSEAGARSRSTLVVGGGLGVGANGLNVLKRLDEDL
LLDVVRGGYVVPTMKMKAKGGALLARTQPGGGGEAGADMHMVASSRHALWTCLRARIPDGAIVTKTVARVVARPE
GRNLVVFADGSPPVEADLVIGADGVKSVAKHALFPEADQDPFPPQYEGLVGVGGFVPSALVRDRVEKGSMNFVFG
GNGFFGYFFANSAPSSPHRESPFHLSEPGDTLAWWSTFTADECPTASTLDADAVTRQLQGRHKDWKDPVVQAILP
SLRVENMYPTWTVPPLPTWERDGVVLIGDAAHALPPTSGQGSSQALEDAEAFTLFLSHHLRRAYQEHRTDTASRK
RVVKTAAKQYMELRIPRVSKILHDAQKRQNSKRDMSVLEEYLMYLYLWIMGCFPSLLSKPVNDVFRYNVAEEVKK
RLGKAET*
Coding >Hirsu2|9479
ATGGAAATCGTCATCCTCGGCGCGGGCATCTCCGGCTGCTCGGCCTATCTGCTGCTGAAGAAGCACCTGCCCAAG
CCTTTGTCAGCAGAACCCCACTCCATCACCATCTTCGAAGCCCACGACAGCGAGGCTGGCGCGCGCTCGAGGTCG
ACGCTGGTCGTCGGCGGCGGCCTGGGCGTCGGCGCCAACGGGCTCAACGTGCTGAAGCGCCTGGACGAGGACCTG
CTGCTCGACGTTGTGCGCGGCGGCTATGTCGTGCCGACGATGAAGATGAAGGCCAAGGGCGGCGCCCTCCTGGCC
CGCACCCAGCCCGGCGGCGGCGGAGAGGCCGGCGCCGACATGCACATGGTCGCCAGCAGCCGCCACGCGCTGTGG
ACGTGCCTGCGCGCGCGCATTCCCGACGGCGCCATCGTCACCAAGACGGTCGCCCGTGTCGTCGCCCGGCCCGAG
GGCCGCAACCTCGTCGTCTTCGCCGACGGGAGCCCGCCCGTCGAGGCGGACCTGGTCATCGGCGCCGACGGCGTC
AAGAGCGTCGCCAAGCACGCCCTGTTTCCCGAGGCCGACCAGGACCCGTTCCCGCCGCAATACGAGGGTCTCGTC
GGCGTCGGCGGCTTCGTCCCCTCCGCCCTCGTCCGGGACCGCGTGGAGAAGGGGTCGATGAACTTCGTCTTCGGC
GGCAACGGCTTCTTCGGCTACTTCTTCGCCAACAGCGCGCCCTCGTCGCCGCACCGCGAGTCCCCCTTCCACCTG
TCCGAGCCGGGCGACACCCTTGCCTGGTGGTCGACCTTTACGGCCGACGAGTGCCCGACGGCCAGCACGCTCGAC
GCCGACGCCGTCACGCGCCAGCTGCAGGGCCGCCACAAGGACTGGAAAGACCCGGTGGTGCAGGCCATCCTGCCC
TCGCTCCGCGTCGAAAACATGTATCCCACCTGGACGGTGCCGCCGCTGCCGACCTGGGAGCGCGACGGCGTCGTC
CTCATCGGCGACGCCGCCCACGCCCTGCCGCCCACGTCGGGCCAGGGGTCATCGCAGGCCCTGGAAGACGCCGAG
GCTTTCACGCTCTTCCTGAGCCACCATCTGCGCAGAGCCTACCAAGAGCACCGGACGGACACGGCCAGCCGCAAG
CGGGTTGTCAAGACGGCCGCGAAGCAGTACATGGAGCTGCGCATCCCCCGCGTCTCCAAGATCCTGCACGACGCG
CAGAAGAGGCAGAACTCGAAGCGGGACATGTCGGTCCTGGAGGAATACCTCATGTACTTGTACTTGTGGATAATG
GGTTGCTTTCCCAGCCTCTTGTCGAAGCCTGTGAACGACGTCTTTCGATACAATGTGGCCGAAGAGGTCAAGAAG
CGATTGGGCAAGGCAGAAACATGA
Transcript >Hirsu2|9479
ATGGAAATCGTCATCCTCGGCGCGGGCATCTCCGGCTGCTCGGCCTATCTGCTGCTGAAGAAGCACCTGCCCAAG
CCTTTGTCAGCAGAACCCCACTCCATCACCATCTTCGAAGCCCACGACAGCGAGGCTGGCGCGCGCTCGAGGTCG
ACGCTGGTCGTCGGCGGCGGCCTGGGCGTCGGCGCCAACGGGCTCAACGTGCTGAAGCGCCTGGACGAGGACCTG
CTGCTCGACGTTGTGCGCGGCGGCTATGTCGTGCCGACGATGAAGATGAAGGCCAAGGGCGGCGCCCTCCTGGCC
CGCACCCAGCCCGGCGGCGGCGGAGAGGCCGGCGCCGACATGCACATGGTCGCCAGCAGCCGCCACGCGCTGTGG
ACGTGCCTGCGCGCGCGCATTCCCGACGGCGCCATCGTCACCAAGACGGTCGCCCGTGTCGTCGCCCGGCCCGAG
GGCCGCAACCTCGTCGTCTTCGCCGACGGGAGCCCGCCCGTCGAGGCGGACCTGGTCATCGGCGCCGACGGCGTC
AAGAGCGTCGCCAAGCACGCCCTGTTTCCCGAGGCCGACCAGGACCCGTTCCCGCCGCAATACGAGGGTCTCGTC
GGCGTCGGCGGCTTCGTCCCCTCCGCCCTCGTCCGGGACCGCGTGGAGAAGGGGTCGATGAACTTCGTCTTCGGC
GGCAACGGCTTCTTCGGCTACTTCTTCGCCAACAGCGCGCCCTCGTCGCCGCACCGCGAGTCCCCCTTCCACCTG
TCCGAGCCGGGCGACACCCTTGCCTGGTGGTCGACCTTTACGGCCGACGAGTGCCCGACGGCCAGCACGCTCGAC
GCCGACGCCGTCACGCGCCAGCTGCAGGGCCGCCACAAGGACTGGAAAGACCCGGTGGTGCAGGCCATCCTGCCC
TCGCTCCGCGTCGAAAACATGTATCCCACCTGGACGGTGCCGCCGCTGCCGACCTGGGAGCGCGACGGCGTCGTC
CTCATCGGCGACGCCGCCCACGCCCTGCCGCCCACGTCGGGCCAGGGGTCATCGCAGGCCCTGGAAGACGCCGAG
GCTTTCACGCTCTTCCTGAGCCACCATCTGCGCAGAGCCTACCAAGAGCACCGGACGGACACGGCCAGCCGCAAG
CGGGTTGTCAAGACGGCCGCGAAGCAGTACATGGAGCTGCGCATCCCCCGCGTCTCCAAGATCCTGCACGACGCG
CAGAAGAGGCAGAACTCGAAGCGGGACATGTCGGTCCTGGAGGAATACCTCATGTACTTGTACTTGTGGATAATG
GGTTGCTTTCCCAGCCTCTTGTCGAAGCCTGTGAACGACGTCTTTCGATACAATGTGGCCGAAGAGGTCAAGAAG
CGATTGGGCAAGGCAGAAACATGA
Gene >Hirsu2|9479
ATGGAAATCGTCATCCTCGGCGCGGGCATCTCCGGCTGCTCGGCCTATCTGCTGCTGAAGAAGCACCTGCCCAAG
CCTTTGTCAGCAGAACCCCACTCCATCACCATCTTCGAAGCCCACGACAGCGAGGCTGGCGCGCGCTCGAGGTCG
ACGCTGGTCGTCGGCGGCGGCCTGGGCGTCGGCGCCAACGGGCTCAACGTGCTGAAGCGCCTGGACGAGGACCTG
CTGCTCGACGTTGTGCGCGGCGGCTATGTCGTGCCGACGATGAAGATGAAGGCCAAGGGCGGCGCCCTCCTGGCC
CGCACCCAGCCCGGCGGCGGCGGAGAGGCCGGCGCCGACATGCACATGGTCGCCAGCAGCCGCCACGCGCTGTGG
ACGTGCCTGCGCGCGCGCATTCCCGACGGCGCCATCGTCACCAAGACGGTCGCCCGTGTCGTCGCCCGGCCCGAG
GGCCGCAACCTCGTCGTCTTCGCCGACGGGAGCCCGCCCGTCGAGGCGGACCTGGTCATCGGCGCCGACGGCGTC
AAGAGCGTCGCCAAGCACGCCCTGTTTCCCGAGGCCGACCAGGACCCGTTCCCGCCGCAATACGAGTAGGCCCGA
CTTCATCTGCTTCGGCTGCTGACGCCCTGGGCTCTGGACTGACGCGCAAGCCGCAGGGGTCTCGTCGGCGTCGGC
GGCTTCGTCCCCTCCGCCCTCGTCCGGGACCGCGTGGAGAAGGGGTCGATGAACTTCGTCTTCGGCGGCAACGGC
TTCTTCGGCTACTTCTTCGCCAACAGCGCGCCCTCGTCGCCGCACCGCGAGTCCCCCTTCCACCTGTCCGAGCCG
GGCGACACCCTTGCCTGGTGGTCGACCTTTACGGCCGACGAGTGCCCGACGGCCAGCACGCTCGACGCCGACGCC
GTCACGCGCCAGCTGCAGGGCCGCCACAAGGACTGGAAAGACCCGGTGGTGCAGGCCATCCTGCCCTCGCTCCGC
GTCGAAAACATGTATCCCACCTGGACGGTGCCGCCGCTGCCGACCTGGGAGCGCGACGGCGTCGTCCTCATCGGC
GACGCCGCCCACGCCCTGCCGCCCACGTCGGGCCAGGGGTCATCGCAGGCCCTGGAAGACGCCGAGGCTTTCACG
CTCTTCCTGAGCCACCATCTGCGCAGAGCCTACCAAGAGCACCGGACGGACACGGCCAGCCGCAAGCGGGTTGTC
AAGACGGCCGCGAAGCAGTACATGGAGCTGCGCATCCCCCGCGTCTCCAAGATCCTGCACGACGCGCAGAAGAGG
CAGAACTCGAAGCGGGACATGTCGGTCCTGGAGGAATACCTCATGTACTTGTACTTGTGGATAATGGGTAAGCCC
TCCGTTTGTCCGTCTGTCAGCGGGACGAGAGCTTATCAGATCCAGGTTGCTTTCCCAGCCTCTTGTCGAAGCCTG
TGAACGACGTCTTTCGATACAATGTGGCCGAAGAGGTCAAGAAGCGATTGGGCAAGGCAGAAACATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail