Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9474
Gene name
LocationContig_692:13064..13692
Strand+
Gene length (bp)628
Transcript length (bp)582
Coding sequence length (bp)582
Protein length (aa) 194

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00732 GMC_oxred_N GMC oxidoreductase 1.9E-04 122 187
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.1E-04 26 60

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7MF12|BETA_VIBVY Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) GN=betA PE=3 SV=1 22 174 6.0E-08
sp|Q8D3K2|BETA_VIBVU Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) GN=betA PE=3 SV=1 22 174 7.0E-08
sp|A7N2P9|BETA_VIBCB Oxygen-dependent choline dehydrogenase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=betA PE=3 SV=1 22 174 1.0E-07
sp|Q6LGH5|BETA_PHOPR Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum GN=betA PE=3 SV=1 22 174 1.0E-07
sp|Q00593|ALKJ_PSEOL Alcohol dehydrogenase [acceptor] OS=Pseudomonas oleovorans GN=alkJ PE=1 SV=1 22 192 2.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7MF12|BETA_VIBVY Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) GN=betA PE=3 SV=1 22 174 6.0E-08
sp|Q8D3K2|BETA_VIBVU Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) GN=betA PE=3 SV=1 22 174 7.0E-08
sp|A7N2P9|BETA_VIBCB Oxygen-dependent choline dehydrogenase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=betA PE=3 SV=1 22 174 1.0E-07
sp|Q6LGH5|BETA_PHOPR Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum GN=betA PE=3 SV=1 22 174 1.0E-07
sp|Q00593|ALKJ_PSEOL Alcohol dehydrogenase [acceptor] OS=Pseudomonas oleovorans GN=alkJ PE=1 SV=1 22 192 2.0E-06
sp|Q4ZM63|BETA_PSEU2 Oxygen-dependent choline dehydrogenase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=betA PE=3 SV=1 20 174 4.0E-06
sp|Q48CM7|BETA_PSE14 Oxygen-dependent choline dehydrogenase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=betA PE=3 SV=1 20 174 4.0E-06
sp|Q8PPG8|BETA_XANAC Oxygen-dependent choline dehydrogenase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=betA PE=3 SV=1 22 174 4.0E-06
sp|A5WA97|BETA_PSEP1 Oxygen-dependent choline dehydrogenase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=betA PE=3 SV=1 22 174 4.0E-06
sp|Q88CW6|BETA_PSEPK Oxygen-dependent choline dehydrogenase OS=Pseudomonas putida (strain KT2440) GN=betA PE=3 SV=1 22 174 4.0E-06
sp|Q1C932|BETA_YERPA Oxygen-dependent choline dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=betA PE=3 SV=1 22 174 5.0E-06
sp|Q88AE7|BETA_PSESM Oxygen-dependent choline dehydrogenase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=betA PE=3 SV=1 20 174 5.0E-06
sp|Q3BXK8|BETA_XANC5 Oxygen-dependent choline dehydrogenase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=betA PE=3 SV=1 22 174 5.0E-06
sp|A7FKL6|BETA_YERP3 Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=betA PE=3 SV=1 22 174 5.0E-06
sp|B2K8U4|BETA_YERPB Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=betA PE=3 SV=1 22 174 5.0E-06
sp|A4TNP2|BETA_YERPP Oxygen-dependent choline dehydrogenase OS=Yersinia pestis (strain Pestoides F) GN=betA PE=3 SV=1 22 174 5.0E-06
sp|Q66D54|BETA_YERPS Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=betA PE=3 SV=1 22 174 5.0E-06
sp|B1JSR0|BETA_YERPY Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=betA PE=3 SV=1 22 174 5.0E-06
sp|Q8ZGW0|BETA_YERPE Oxygen-dependent choline dehydrogenase OS=Yersinia pestis GN=betA PE=3 SV=1 22 174 5.0E-06
sp|Q1CFR7|BETA_YERPN Oxygen-dependent choline dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=betA PE=3 SV=1 22 174 5.0E-06
sp|B0KN19|BETA_PSEPG Oxygen-dependent choline dehydrogenase OS=Pseudomonas putida (strain GB-1) GN=betA PE=3 SV=1 22 174 6.0E-06
sp|Q8G1Z8|BETA_BRUSU Oxygen-dependent choline dehydrogenase OS=Brucella suis biovar 1 (strain 1330) GN=betA PE=3 SV=1 23 185 7.0E-06
sp|A9M9H8|BETA_BRUC2 Oxygen-dependent choline dehydrogenase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=betA PE=3 SV=1 23 185 7.0E-06
sp|B0CKN4|BETA_BRUSI Oxygen-dependent choline dehydrogenase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=betA PE=3 SV=1 23 185 7.0E-06
sp|A5VPA6|BETA_BRUO2 Oxygen-dependent choline dehydrogenase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=betA PE=3 SV=1 23 185 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055114 oxidation-reduction process Yes
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0050662 coenzyme binding No
GO:0005488 binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0008150 biological_process No
GO:0048037 cofactor binding No
GO:1901363 heterocyclic compound binding No
GO:0008152 metabolic process No
GO:0016491 oxidoreductase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9474
MKVSLASAALASVAAAVELSGYDYIVVGAGAGGGPLAARLAMAGHKTLLIEAGGDPGVNVNYTVPAYSAKSSEDE
TMAWNFFVRHYADDERQARDYKTTYETSDGQLYTGLHPPPGARMLGTLYPRAAALGGCSVHNALVTVYPHRSDFD
ALALLTGDASWSAKRMRRYFARLERNRYLLPGLKGHGYDGWLC*
Coding >Hirsu2|9474
ATGAAAGTCAGCCTCGCCTCTGCCGCGCTCGCCTCGGTGGCCGCAGCGGTCGAGCTCTCCGGCTATGACTACATC
GTCGTCGGCGCCGGGGCCGGCGGCGGCCCGCTGGCGGCGCGGCTGGCCATGGCCGGGCACAAGACGCTCCTCATC
GAGGCCGGCGGCGACCCGGGCGTCAACGTCAACTACACGGTGCCGGCCTACTCGGCCAAGTCGTCCGAGGACGAG
ACCATGGCCTGGAACTTCTTCGTCCGGCACTACGCCGACGACGAGCGGCAGGCGCGCGACTACAAGACGACGTAC
GAGACGAGCGACGGCCAGCTCTACACCGGCCTGCACCCGCCGCCGGGCGCGCGCATGCTGGGCACGCTGTACCCG
CGCGCCGCCGCCCTGGGCGGCTGCTCCGTCCACAACGCCCTCGTCACCGTCTACCCGCACCGGTCCGACTTCGAC
GCGCTGGCGCTGCTGACGGGCGACGCCTCGTGGTCGGCGAAGCGCATGAGGCGCTACTTCGCCCGCCTCGAGCGC
AACCGCTACCTCCTGCCGGGGCTCAAGGGCCACGGCTACGACGGCTGGCTCTGCTGA
Transcript >Hirsu2|9474
ATGAAAGTCAGCCTCGCCTCTGCCGCGCTCGCCTCGGTGGCCGCAGCGGTCGAGCTCTCCGGCTATGACTACATC
GTCGTCGGCGCCGGGGCCGGCGGCGGCCCGCTGGCGGCGCGGCTGGCCATGGCCGGGCACAAGACGCTCCTCATC
GAGGCCGGCGGCGACCCGGGCGTCAACGTCAACTACACGGTGCCGGCCTACTCGGCCAAGTCGTCCGAGGACGAG
ACCATGGCCTGGAACTTCTTCGTCCGGCACTACGCCGACGACGAGCGGCAGGCGCGCGACTACAAGACGACGTAC
GAGACGAGCGACGGCCAGCTCTACACCGGCCTGCACCCGCCGCCGGGCGCGCGCATGCTGGGCACGCTGTACCCG
CGCGCCGCCGCCCTGGGCGGCTGCTCCGTCCACAACGCCCTCGTCACCGTCTACCCGCACCGGTCCGACTTCGAC
GCGCTGGCGCTGCTGACGGGCGACGCCTCGTGGTCGGCGAAGCGCATGAGGCGCTACTTCGCCCGCCTCGAGCGC
AACCGCTACCTCCTGCCGGGGCTCAAGGGCCACGGCTACGACGGCTGGCTCTGCTGA
Gene >Hirsu2|9474
ATGAAAGTCAGCCTCGCCTCTGCCGCGCTCGCCTCGGTGGCCGCAGCGGTCGAGCTCTCCGGCTATGACTACATC
GTCGTCGGCGCCGGGGCCGGCGGCGGCCCGCTGGCGGCGCGGCTGGCCATGGCCGGGCACAAGACGCTCCTCATC
GAGGCCGGCGGCGACCCGGGCGTCAACGTCAACTACACGGTGCCGGCCTACTCGGCCAAGTCGTCCGAGGACGAG
ACCATGGCCTGGAACTTCTTCGTCCGGCACTACGCCGACGACGAGCGGCAGGCGCGCGACTACAAGACGACGTAC
GAGACGAGCGACGGCCAGCTCTACACCGGCCTGCACCCGCCGCCGGGCGCGCGCATGCTGGGCACGCTGTACCCG
CGCGCCGCCGCCCTGGGCGGCTGCTCCGTCCACAACGCCCTCGTCACCGTCTACCCGCACCGGTCCGACTTCGAC
GCGCTGGCGCTGCTGACGGGCGACGCCTCGTGGTCGGCGAAGCGCATGAGGCGCTACTTCGCCCGCCTCGAGCGC
AACCGCTACCTCCTGCCGGGGCTCAAGGGCCACGGCTACGACGGCTGGCTGTCGACGGAGACGGCGCCGCTGACC
ATCGCCCTGACCGACCCGGAGCTGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail